FAM114A1 (NM_138389) Human Mass Spec Standard

SKU
PH303837
FAM114A1 MS Standard C13 and N15-labeled recombinant protein (NP_612398)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203837]
Predicted MW 60.8 kDa
Protein Sequence
Protein Sequence
>RC203837 protein sequence
Red=Cloning site Green=Tags(s)

MSDDAGDTLATGDKAEVTEMPNSDSLPEDAEVHCDSAAVSHEPTPADPRGEGHENAAVQGAGAAAIGPPV
QPQDANALEPPLNRDVTEDTLAECIDSVSLEAEPRSEIPLQEQNYPAVDSPPSGGGWAGWGSWGKSLLSS
ASATVGHGLTAVKEKAGATLRIHGVNSGSSEGAQPNTENGVPEITDAATDQGPAESPPTSPSSASRGMLS
AITNVVQNTGKSVLTGGLDALEFIGKKTMNVLAESDPGFKRTKTLMERTVSLSQMLREAKEKEKQRLAQQ
LTMERTAHYGMLFDEYQGLSHLEALEILSNESESKVQSFLASLDGEKLELLKNDLISIKDIFAAKELENE
ENQEEQGLEEKGEEFARMLTELLFELHVAATPDKLNKAMKRAHDWVEEDQTVVSVDVAKVSEEETKKEEK
EEKSQDPQEDKKEEKKTKTIEEVYMSSIESLAEVTARCIEQLHKVAELILHGQEEEKPAQDQAKVLIKLT
TAMCNEVASLSKKFTNSLTTVGSNKKAEVLNPMISSVLLEGCNSTTYIQDAFQLLLPVLQVSHIQTSCLK
AQP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612398
RefSeq Size 4138
RefSeq ORF 1689
Synonyms Noxp20
Locus ID 92689
UniProt ID Q8IWE2
Cytogenetics 4p14
Summary The protein encoded by this gene belongs to the FAM114 family and may play a role in neuronal cell development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2017]
Write Your Own Review
You're reviewing:FAM114A1 (NM_138389) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408653 FAM114A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408653 Transient overexpression lysate of family with sequence similarity 114, member A1 (FAM114A1), transcript variant 1 100 ug
$436.00
TP303837 Recombinant protein of human family with sequence similarity 114, member A1 (FAM114A1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.