ZFAND2B (NM_138802) Human Mass Spec Standard

CAT#: PH303822

ZFAND2B MS Standard C13 and N15-labeled recombinant protein (NP_620157)

Product Images

Coomassie blue staining of purified ZFAND2B protein (Cat# TP303822). The protein was produced from HEK293T cells transfected with ZFAND2B cDNA clone (Cat# RC203822) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203822
• Predicted MW: 28 kDa
• Protein Sequence:
  Sequence Link

  >RC203822 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLCNVPVPVARGE
  PPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHPLDHDCSGEGHP
  TSRAGLAAISRAQAVASTSTVPSPSQTMPSCTSPSRATTRSPSWTAPPVIALQNGLSEDEALQRALEMSL
  AETKPQVPSCQEEEDLALAQALSASEAEYQRQQAQSRSSKPSNCSLC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_620157
• RefSeq Size: 1323
• RefSeq ORF: 771
• Synonyms: AIRAPL
• Locus ID: 130617
• UniProt ID: Q8WV99
• Cytogenetics: 2q35
• Summary: This gene encodes a protein containing AN1-type zinc-fingers and ubiquitin-interacting motifs. The encoded protein likely associates with the proteosome to stimulate the degradation of toxic or misfolded proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012]