ZFAND2B (NM_138802) Human Mass Spec Standard

SKU
PH303822
ZFAND2B MS Standard C13 and N15-labeled recombinant protein (NP_620157)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203822]
Predicted MW 28 kDa
Protein Sequence
Protein Sequence
>RC203822 protein sequence
Red=Cloning site Green=Tags(s)

MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQKDIQVPVCPLCNVPVPVARGE
PPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERAGCRQREMMKLTCERCSRNFCIKHRHPLDHDCSGEGHP
TSRAGLAAISRAQAVASTSTVPSPSQTMPSCTSPSRATTRSPSWTAPPVIALQNGLSEDEALQRALEMSL
AETKPQVPSCQEEEDLALAQALSASEAEYQRQQAQSRSSKPSNCSLC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620157
RefSeq Size 1323
RefSeq ORF 771
Synonyms AIRAPL
Locus ID 130617
UniProt ID Q8WV99
Cytogenetics 2q35
Summary This gene encodes a protein containing AN1-type zinc-fingers and ubiquitin-interacting motifs. The encoded protein likely associates with the proteosome to stimulate the degradation of toxic or misfolded proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2012]
Write Your Own Review
You're reviewing:ZFAND2B (NM_138802) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408488 ZFAND2B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408488 Transient overexpression lysate of zinc finger, AN1-type domain 2B (ZFAND2B) 100 ug
$436.00
TP303822 Recombinant protein of human zinc finger, AN1-type domain 2B (ZFAND2B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.