C1QB (NM_000491) Human Mass Spec Standard

SKU PH303821

C1QB MS Standard C13 and N15-labeled recombinant protein (NP_000482)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC203821]
• Predicted MW: 26.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC203821 protein sequence; Red=Cloning site Green=Tags(s); ; MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGD; HGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTI; RFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTG; GMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_000482
• RefSeq Size: 1044
• RefSeq ORF: 759
• Locus ID: 713
• UniProt ID: P02746
• Cytogenetics: 1p36.12
• Summary: This gene encodes the B-chain polypeptide of serum complement subcomponent C1q, which associates with C1r and C1s to yield the first component of the serum complement system. C1q is composed of 18 polypeptide chains which include 6 A-chains, 6 B-chains, and 6 C-chains. Each chain contains an N-terminal collagen-like region and a C-terminal C1q globular domain. C1q deficiency is associated with lupus erythematosus and glomerulonephritis. [provided by RefSeq, Dec 2016]
• Protein Families: Secreted Protein
• Protein Pathways: Complement and coagulation cascades, Prion diseases, Systemic lupus erythematosus