HMGCL (NM_000191) Human Mass Spec Standard

SKU
PH303817
HMGCL MS Standard C13 and N15-labeled recombinant protein (NP_000182)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203817]
Predicted MW 34.4 kDa
Protein Sequence
Protein Sequence
>RC203817 protein sequence
Red=Cloning site Green=Tags(s)

MAAMRKALPRRLVGLASLRAVSTSSMGTLPKRVKIVEVGPRDGLQNEKNIVSTPVKIKLIDMLSEAGLSV
IETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAASELFTKKNIN
CSIEESFQRFDAILKAAQSANISVRGYVSCALGCPYEGKISPAKVAEVTKKFYSMGCYEISLGDTIGVGT
PGIMKDMLSAVMQEVPLAALAVHCHDTYGQALANTLMALQMGVSVVDSSVAGLGGCPYAQGASGNLATED
LVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000182
RefSeq Size 1617
RefSeq ORF 975
Synonyms HL
Locus ID 3155
UniProt ID P35914
Cytogenetics 1p36.11
Summary The protein encoded by this gene belongs to the HMG-CoA lyase family. It is a mitochondrial enzyme that catalyzes the final step of leucine degradation and plays a key role in ketone body formation. Mutations in this gene are associated with HMG-CoA lyase deficiency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]
Protein Families Druggable Genome
Protein Pathways Butanoate metabolism, leucine and isoleucine degradation, Metabolic pathways, Synthesis and degradation of ketone bodies, Valine
Write Your Own Review
You're reviewing:HMGCL (NM_000191) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424872 HMGCL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431216 HMGCL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424872 Transient overexpression lysate of 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase (HMGCL), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$436.00
LY431216 Transient overexpression lysate of 3-hydroxymethyl-3-methylglutaryl-CoA lyase (HMGCL), nuclear gene encoding mitochondrial protein, transcript variant 2 100 ug
$436.00
TP303817 Recombinant protein of human 3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase (HMGCL), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.