Acid Phosphatase (ACP1) (NM_007099) Human Mass Spec Standard

SKU
PH301078
ACP1 MS Standard C13 and N15-labeled recombinant protein (NP_009030)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201078]
Predicted MW 18 kDa
Protein Sequence
Protein Sequence
>RC201078 protein sequence
Red=Cloning site Green=Tags(s)

MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIH
TAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFE
TVYQQCVRCCRAFLEKAH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009030
RefSeq Size 1568
RefSeq ORF 474
Synonyms HAAP; LMW-PTP; LMWPTP
Locus ID 52
UniProt ID P24666
Cytogenetics 2p25.3
Summary The product of this gene belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate. This gene is genetically polymorphic, and three common alleles segregating at the corresponding locus give rise to six phenotypes. Each allele appears to encode at least two electrophoretically different isozymes, Bf and Bs, which are produced in allele-specific ratios. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2008]
Protein Families Druggable Genome, Phosphatase, Transmembrane
Protein Pathways Adherens junction, Riboflavin metabolism
Write Your Own Review
You're reviewing:Acid Phosphatase (ACP1) (NM_007099) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH312653 ACP1 MS Standard C13 and N15-labeled recombinant protein (NP_004291) 10 ug
$3,255.00
LC402090 ACP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418090 ACP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402090 Transient overexpression lysate of acid phosphatase 1, soluble (ACP1), transcript variant 2 100 ug
$436.00
LY418090 Transient overexpression lysate of acid phosphatase 1, soluble (ACP1), transcript variant 3 100 ug
$436.00
TP301078 Recombinant protein of human acid phosphatase 1, soluble (ACP1), transcript variant 2, 20 µg 20 ug
$867.00
TP312653 Recombinant protein of human acid phosphatase 1, soluble (ACP1), transcript variant 3, 20 µg 20 ug
$867.00
TP720178 Recombinant protein of human acid phosphatase 1, soluble (ACP1), transcript variant 3 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.