OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ESD (NM_001984) Human Mass Spec Standard

Be the first to review this product
SKU
PH300533
ESD MS Standard C13 and N15-labeled recombinant protein (NP_001975)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA375990 ESD Rabbit polyclonal Antibody
100 ul
$410.00
LY419606 Transient overexpression lysate of esterase D/formylglutathione hydrolase (ESD) (as WB positive control) 100 ug
$436.00

Other products for "ESD or NM_001984"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200533
Predicted MW 31.5 kDa
Protein Sequence
Protein Sequence
>RC200533 protein sequence
Red=Cloning site Green=Tags(s)

MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQS
ASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQLINANFPVDP
QRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQSKWKAYDATHLVKS
YPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEDYDHSYYFIATFITDHIRHHAKYL
NA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001975
RefSeq Size 1208
RefSeq ORF 846
Synonyms FGH
Locus ID 2098
UniProt ID P10768
Cytogenetics 13q14.2
Summary This gene encodes a serine hydrolase that belongs to the esterase D family. The encoded enzyme is active toward numerous substrates including O-acetylated sialic acids, and it may be involved in the recycling of sialic acids. This gene is used as a genetic marker for retinoblastoma and Wilson's disease. provided by RefSeq, Feb 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ESD" proteins (4)
SKU Description Size Price
LC419606 Lyophilized ESD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419606 Transient overexpression lysate of esterase D/formylglutathione hydrolase (ESD) (as WB positive control) 100 ug
$436.00
TP300533 Recombinant protein of human esterase D/formylglutathione hydrolase (ESD), 20 µg 20 ug
$867.00
TP720113 Recombinant protein of human esterase D/formylglutathione hydrolase (ESD) 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products