ESD (NM_001984) Human Mass Spec Standard

SKU
PH300533
ESD MS Standard C13 and N15-labeled recombinant protein (NP_001975)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200533]
Predicted MW 31.5 kDa
Protein Sequence
Protein Sequence
>RC200533 protein sequence
Red=Cloning site Green=Tags(s)

MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYWLSGLTCTEQNFISKSGYHQS
ASEHGLVVIAPDTSPRGCNIKGEDESWDFGTGAGFYVDATEDPWKTNYRMYSYVTEELPQLINANFPVDP
QRMSIFGHSMGGHGALICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQSKWKAYDATHLVKS
YPGSQLDILIDQGKDDQFLLDGQLLPDNFIAACTEKKIPVVFRLQEDYDHSYYFIATFITDHIRHHAKYL
NA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001975
RefSeq Size 1208
RefSeq ORF 846
Synonyms FGH
Locus ID 2098
UniProt ID P10768
Cytogenetics 13q14.2
Summary This gene encodes a serine hydrolase that belongs to the esterase D family. The encoded enzyme is active toward numerous substrates including O-acetylated sialic acids, and it may be involved in the recycling of sialic acids. This gene is used as a genetic marker for retinoblastoma and Wilson's disease. [provided by RefSeq, Feb 2009]
Write Your Own Review
You're reviewing:ESD (NM_001984) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419606 ESD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419606 Transient overexpression lysate of esterase D/formylglutathione hydrolase (ESD) 100 ug
$436.00
TP300533 Recombinant protein of human esterase D/formylglutathione hydrolase (ESD), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720113 Recombinant protein of human esterase D/formylglutathione hydrolase (ESD) 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.