Glucose Transporter 5 GLUT5 (SLC2A5) (NM_003039) Human Mass Spec Standard

CAT#: PH300418

SLC2A5 MS Standard C13 and N15-labeled recombinant protein (NP_003030)

Product Images

Coomassie blue staining of purified SLC2A5 protein (Cat# TP300418). The protein was produced from HEK293T cells transfected with SLC2A5 cDNA clone (Cat# RC200418) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200418
• Predicted MW: 55 kDa
• Protein Sequence:
  Sequence Link

  >RC200418 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGEFMEDFPLTLL
  WSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSRVATSFELIIISRLLVGICAG
  VSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIFGLRNLLANVDGWPILLGLTGVPAALQLLLL
  PFFPESPRYLLIQKKDEAAAKKALQTLRGWDSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQLLS
  IIVLMGGQQLSGVNAIYYYADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGFS
  ICLIACCVLTAALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLITEIFLQSSRPSAFMVGGSVHW
  LSNFTVGLIFPFIQEGLGPYSFIVFAVICLLTTIYIFLIVPETKAKTFIEINQIFTKMNKVSEVYPEKEE
  LKELPPVTSEQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003030
• RefSeq Size: 2454
• RefSeq ORF: 1503
• Synonyms: GLUT-5; GLUT5
• Locus ID: 6518
• UniProt ID: P22732
• Cytogenetics: 1p36.23
• Summary: The protein encoded by this gene is a fructose transporter responsible for fructose uptake by the small intestine. The encoded protein also is necessary for the increase in blood pressure due to high dietary fructose consumption. [provided by RefSeq, Jun 2016]
• Protein Families: Transmembrane