Sorbitol Dehydrogenase (SORD) (NM_003104) Human Mass Spec Standard

SKU
PH300415
SORD MS Standard C13 and N15-labeled recombinant protein (NP_003095)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200415]
Predicted MW 38.3 kDa
Protein Sequence
Protein Sequence
>RC200415 protein sequence
Red=Cloning site Green=Tags(s)

MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGH
EASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFC
YKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRL
SKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMT
TVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKC
DPSDQNP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003095
RefSeq Size 2813
RefSeq ORF 1071
Synonyms HEL-S-95n; RDH; SDH; SORD1; SORDD; XDH
Locus ID 6652
UniProt ID Q00796
Cytogenetics 15q21.1
Summary Sorbitol dehydrogenase (SORD; EC 1.1.1.14) catalyzes the interconversion of polyols and their corresponding ketoses, and together with aldose reductase (ALDR1; MIM 103880), makes up the sorbitol pathway that is believed to play an important role in the development of diabetic complications (summarized by Carr and Markham, 1995 [PubMed 8535074]). The first reaction of the pathway (also called the polyol pathway) is the reduction of glucose to sorbitol by ALDR1 with NADPH as the cofactor. SORD then oxidizes the sorbitol to fructose using NAD(+) cofactor.[supplied by OMIM, Jul 2010]
Protein Families Druggable Genome
Protein Pathways Fructose and mannose metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:Sorbitol Dehydrogenase (SORD) (NM_003104) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401082 SORD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401082 Transient overexpression lysate of sorbitol dehydrogenase (SORD) 100 ug
$436.00
TP300415 Recombinant protein of human sorbitol dehydrogenase (SORD), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.