UBE2G2 (NM_003343) Human Mass Spec Standard
CAT#: PH300407
UBE2G2 MS Standard C13 and N15-labeled recombinant protein (NP_003334)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200407 |
Predicted MW | 18.6 kDa |
Protein Sequence |
>RC200407 protein sequence
Red=Cloning site Green=Tags(s) MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPK MRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDA SKMWRDDREQFYKIAKQIVQKSLGL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003334 |
RefSeq Size | 3400 |
RefSeq ORF | 495 |
Synonyms | UBC7 |
Locus ID | 7327 |
UniProt ID | P60604 |
Cytogenetics | 21q22.3 |
Summary | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse counterpart. This gene is ubiquitously expressed, with high expression seen in adult muscle. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jan 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Parkinson's disease, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405451 | UBE2G2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC418761 | UBE2G2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY405451 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast) (UBE2G2), transcript variant 2 |
USD 436.00 |
|
LY418761 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast) (UBE2G2), transcript variant 1 |
USD 436.00 |
|
TP300407 | Recombinant protein of human ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast) (UBE2G2), transcript variant 1, 20 µg |
USD 867.00 |
|
TP720512 | Recombinant protein of human ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast) (UBE2G2), transcript variant 1 |
USD 330.00 |
|
TP760269 | Recombinant protein of human ubiquitin-conjugating enzyme E2G 2 (UBE2G2), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review