HAUS4 (NM_017815) Human Mass Spec Standard

SKU
PH300173
HAUS4 MS Standard C13 and N15-labeled recombinant protein (NP_060285)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200173]
Predicted MW 42.4 kDa
Protein Sequence
Protein Sequence
>RC200173 protein sequence
Red=Cloning site Green=Tags(s)

MASGDFCSPGEGMEILQQVCSKQLPPCNLSKEDLLQNPYFSKLLLNLSQHVDESGLSLTLAKEQAQAWKE
VRLHKTTWLRSEILHRVIQELLVDYYVKIQDTNVTSEDKKFHETLEQRLLVTELMRLLGPSQEREIPPLL
GLEKADLLELMPLSEDFVWMRARLQQEVEEQLKKKCFTLLCYYDPNSDADSETVKAAKVWKLAEVLVGEQ
QQCQDAKSQQKEQMLLLEKKSAAYSQVLLRCLTLLQRLLQEHRLKTQSELDRINAQYLEVKCGAMILKLR
MEELKILSDTYTVEKVEVHRLIRDRLEGAIHLQEQDMENSRQVLNSYEVLGEEFDRLVKEYTVLKQATEN
KRWALQEFSKVYR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060285
RefSeq Size 1649
RefSeq ORF 1089
Synonyms C14orf94
Locus ID 54930
UniProt ID Q9H6D7
Cytogenetics 14q11.2
Summary This gene encodes a subunit of the centrosome complex termed the human augmin complex. The encoded protein localizes to the spindle microtubules and may play a role in mitotic spindle assembly and maintenance of centrosome integrity during cell division. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 1. [provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:HAUS4 (NM_017815) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413524 HAUS4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432875 HAUS4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432946 HAUS4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413524 Transient overexpression lysate of HAUS augmin-like complex, subunit 4 (HAUS4), transcript variant 2 100 ug
$436.00
LY432875 Transient overexpression lysate of HAUS augmin-like complex, subunit 4 (HAUS4), transcript variant 3 100 ug
$436.00
LY432946 Transient overexpression lysate of HAUS augmin-like complex, subunit 4 (HAUS4), transcript variant 1 100 ug
$436.00
TP300173 Recombinant protein of human chromosome 14 open reading frame 94 (C14orf94), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.