NANS (NM_018946) Human Mass Spec Standard

SKU
PH300123
NANS MS Standard C13 and N15-labeled recombinant protein (NP_061819)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200123]
Predicted MW 40.3 kDa
Protein Sequence
Protein Sequence
>RC200123 protein sequence
Red=Cloning site Green=Tags(s)

MPLELELCPGRWVGGQHPCFIIAEIGQNHQGDLDVAKRMIRMAKECGADCAKFQKSELEFKFNRKALERP
YTSKHSWGKTYGEHKRHLEFSHDQYRELQRYAEEVGIFFTASGMDEMAVEFLHELNVPFFKVGSGDTNNF
PYLEKTAKKGRPMVISSGMQSMDTMKQVYQIVKPLNPNFCFLQCTSAYPLQPEDVNLRVISEYQKLFPDI
PIGYSGHETGIAISVAAVALGAKVLERHITLDKTWKGSDHSASLEPGELAELVRSVRLVERALGSPTKQL
LPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELV
DNHGKKIKS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061819
RefSeq Size 1257
RefSeq ORF 1077
Synonyms HEL-S-100; SAS; SEMDCG; SEMDG
Locus ID 54187
UniProt ID Q9NR45
Cytogenetics 9q22.33
Summary This gene encodes an enzyme that functions in the biosynthetic pathways of sialic acids. In vitro, the encoded protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively; however, it exhibits much higher activity toward the Neu5Ac phosphate product. In insect cells, expression of this gene results in Neu5Ac and KDN production. This gene is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant. [provided by RefSeq, Jul 2008]
Protein Pathways Amino sugar and nucleotide sugar metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:NANS (NM_018946) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC412808 NANS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412808 Transient overexpression lysate of N-acetylneuraminic acid synthase (NANS) 100 ug
$436.00
TP300123 Recombinant protein of human N-acetylneuraminic acid synthase (NANS), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720942 Purified recombinant protein of Human N-acetylneuraminic acid synthase (NANS) 10 ug
$250.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.