OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

N acetylglucosamine kinase (NAGK) (NM_017567) Human Mass Spec Standard

Be the first to review this product
SKU
PH300113
NAGK MS Standard C13 and N15-labeled recombinant protein (NP_060037)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370851 NAGK rabbit polyclonal antibody
100 ul
$310.00
LY413709 Transient overexpression lysate of N-acetylglucosamine kinase (NAGK) (as WB positive control) 100 ug
$436.00

Other products for "N acetylglucosamine kinase or NM_017567"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200113
Predicted MW 37.4 kDa
Protein Sequence
Protein Sequence
>RC200113 protein sequence
Red=Cloning site Green=Tags(s)

MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRS
LGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSE
SGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDK
CRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLK
EGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060037
RefSeq Size 1801
RefSeq ORF 1032
Synonyms GNK; HSA242910
Locus ID 55577
UniProt ID Q9UJ70
Cytogenetics 2p13.3
Summary This gene encodes a member of the N-acetylhexosamine kinase family. The encoded protein catalyzes the conversion of N-acetyl-D-glucosamine to N-acetyl-D-glucosamine 6-phosphate, and is the major mammalian enzyme which recovers amino sugars. provided by RefSeq, Nov 2011
Protein Families Druggable Genome
Protein Pathways Amino sugar and nucleotide sugar metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "N acetylglucosamine kinase" proteins (3)
SKU Description Size Price
LC413709 Lyophilized NAGK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413709 Transient overexpression lysate of N-acetylglucosamine kinase (NAGK) (as WB positive control) 100 ug
$436.00
TP300113 Recombinant protein of human N-acetylglucosamine kinase (NAGK), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products