N acetylglucosamine kinase (NAGK) (NM_017567) Human Mass Spec Standard

SKU
PH300113
NAGK MS Standard C13 and N15-labeled recombinant protein (NP_060037)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200113]
Predicted MW 37.4 kDa
Protein Sequence
Protein Sequence
>RC200113 protein sequence
Red=Cloning site Green=Tags(s)

MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRS
LGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSE
SGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDK
CRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLK
EGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060037
RefSeq Size 1801
RefSeq ORF 1032
Synonyms GNK; HSA242910
Locus ID 55577
UniProt ID Q9UJ70
Cytogenetics 2p13.3
Summary This gene encodes a member of the N-acetylhexosamine kinase family. The encoded protein catalyzes the conversion of N-acetyl-D-glucosamine to N-acetyl-D-glucosamine 6-phosphate, and is the major mammalian enzyme which recovers amino sugars. [provided by RefSeq, Nov 2011]
Protein Families Druggable Genome
Protein Pathways Amino sugar and nucleotide sugar metabolism
Write Your Own Review
You're reviewing:N acetylglucosamine kinase (NAGK) (NM_017567) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413709 NAGK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413709 Transient overexpression lysate of N-acetylglucosamine kinase (NAGK) 100 ug
$436.00
TP300113 Recombinant protein of human N-acetylglucosamine kinase (NAGK), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.