Bif (SH3GLB1) (NM_016009) Human Mass Spec Standard

SKU
PH300106
SH3GLB1 MS Standard C13 and N15-labeled recombinant protein (NP_057093)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200106]
Predicted MW 40.8 kDa
Protein Sequence
Protein Sequence
>RC200106 protein sequence
Red=Cloning site Green=Tags(s)

MNIMDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPN
PNARIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSA
LNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQSEFDRQAEITR
LLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLGSFPSNYLSNNNQTSVTPVPSVLPNAIG
SSAMASTSGLVITSPSNLSDLKECSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERG
NQKGKVPITYLELLN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057093
RefSeq Size 6382
RefSeq ORF 1095
Synonyms Bif-1; CGI-61; dJ612B15.2; PPP1R70
Locus ID 51100
UniProt ID Q9Y371
Cytogenetics 1p22.3
Summary This gene encodes a SRC homology 3 domain-containing protein. The encoded protein interacts with the proapoptotic member of the Bcl-2 family, Bcl-2-associated X protein (Bax) and may be involved in regulating apoptotic signaling pathways. This protein may also be involved in maintaining mitochondrial morphology. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:Bif (SH3GLB1) (NM_016009) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414250 SH3GLB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414250 Transient overexpression lysate of SH3-domain GRB2-like endophilin B1 (SH3GLB1) 100 ug
$436.00
TP300106 Recombinant protein of human SH3-domain GRB2-like endophilin B1 (SH3GLB1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.