Germany
Japan
United Kingdom
China
NDUFA8 (NM_014222) Human Mass Spec Standard
CAT#: PH300061
NDUFA8 MS Standard C13 and N15-labeled recombinant protein (NP_055037)
Product Images
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200061 |
| Predicted MW | 20.1 kDa |
| Protein Sequence |
>RC200061 protein sequence
Red=Cloning site Green=Tags(s) MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDF FRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPEN PYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
| Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_055037 |
| RefSeq Size | 859 |
| RefSeq ORF | 516 |
| Synonyms | CI-19KD; CI-PGIV; MC1DN37; PGIV |
| Locus ID | 4702 |
| UniProt ID | P51970 |
| Cytogenetics | 9q33.2 |
| Summary | The protein encoded by this gene belongs to the complex I 19 kDa subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015] |
| Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415437 | NDUFA8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
| LY415437 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa (NDUFA8), nuclear gene encoding mitochondrial protein |
USD 436.00 |
|
| TP300061 | Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa (NDUFA8), nuclear gene encoding mitochondrial protein, 20 µg |
USD 867.00 |
|
| TP761555 | Purified recombinant protein of Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa (NDUFA8), nuclear gene encoding mitochondrial protein, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 261.00 |
{0} Product Review(s)
Be the first one to submit a review