OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DCXR (NM_016286) Human Mass Spec Standard

Be the first to review this product
SKU
PH300023
DCXR MS Standard C13 and N15-labeled recombinant protein (NP_057370)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA500820 Anti-DCXR mouse monoclonal antibody, clone OTI4D11 (formerly 4D11) 100 ul
$447.00
LY402535 Transient overexpression lysate of dicarbonyl/L-xylulose reductase (DCXR) (as WB positive control) 100 ug
$436.00

Other products for "DCXR or NM_016286"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200023
Predicted MW 25.9 kDa
Protein Sequence
Protein Sequence
>RC200023 protein sequence
Red=Cloning site Green=Tags(s)

MELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRECPGIEPVCVDLGDWEATERA
LGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSSQCSQ
RAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFA
EVEHVVNAILFLLSDRSGMTTGSTLPVEGGFWAC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057370
RefSeq Size 860
RefSeq ORF 732
Synonyms DCR; HCR2; HCRII; KIDCR; P34H; PNTSU; SDR20C1; XR
Locus ID 51181
UniProt ID Q7Z4W1
Cytogenetics 17q25.3
Summary The protein encoded by this gene acts as a homotetramer to catalyze diacetyl reductase and L-xylulose reductase reactions. The encoded protein may play a role in the uronate cycle of glucose metabolism and in the cellular osmoregulation in the proximal renal tubules. Defects in this gene are a cause of pentosuria. Two transcript variants encoding different isoforms have been found for this gene.provided by RefSeq, Aug 2010
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Pentose and glucuronate interconversions
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DCXR" proteins (6)
SKU Description Size Price
LC402535 Lyophilized DCXR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434088 Lyophilized DCXR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402535 Transient overexpression lysate of dicarbonyl/L-xylulose reductase (DCXR) (as WB positive control) 100 ug
$436.00
LY434088 Transient overexpression lysate of dicarbonyl/L-xylulose reductase (DCXR), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300023 Recombinant protein of human dicarbonyl/L-xylulose reductase (DCXR), 20 µg 20 ug
$867.00
TP720249 Recombinant protein of human dicarbonyl/L-xylulose reductase (DCXR), transcript variant 2. 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products