OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TEX264 (NM_015926) Human Mass Spec Standard

Be the first to review this product
SKU
PH300008
TEX264 MS Standard C13 and N15-labeled recombinant protein (NP_057010)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA341988 Rabbit Polyclonal Anti-TEX264 Antibody
100 ul
$585.00
LY414327 Transient overexpression lysate of testis expressed 264 (TEX264), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "TEX264 or NM_015926"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200008
Predicted MW 34.2 kDa
Protein Sequence
Protein Sequence
>RC200008 protein sequence
Red=Cloning site Green=Tags(s)

MSDLLLLGLIGGLTLLLLLTLLAFAGYSGLLAGVEVSAGSPPIRNVTVAYKFHMGLYGETGRLFTESCSI
SPKLRSIAVYYDNPHMVPPDKCRCAVGSILSEGEESPSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTT
ILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYVPEMKETEWKWRGLVEAID
TQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEG
EGPLGESRLDPGTEPLGTTKWLWEPTAPEKGKE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057010
RefSeq Size 1403
RefSeq ORF 939
Synonyms ZSIG11
Locus ID 51368
UniProt ID Q9Y6I9
Cytogenetics 3p21.2
Summary Major reticulophagy (also called ER-phagy) receptor that acts independently of other candidate reticulophagy receptors to remodel subdomains of the endoplasmic reticulum into autophagosomes upon nutrient stress, which then fuse with lysosomes for endoplasmic reticulum turnover (PubMed:31006538, PubMed:31006537). The ATG8-containing isolation membrane (IM) cradles a tubular segment of TEX264-positive ER near a three-way junction, allowing the formation of a synapse of 2 juxtaposed membranes with trans interaction between the TEX264 and ATG8 proteins (PubMed:31006537). Expansion of the IM would extend the capture of ER, possibly through a 'zipper-like' process involving continued trans TEX264-ATG8 interactions, until poorly understood mechanisms lead to the fission of relevant membranes and, ultimately, autophagosomal membrane closure (PubMed:31006537).UniProtKB/Swiss-Prot Function
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TEX264" proteins (5)
SKU Description Size Price
LC414327 Lyophilized TEX264 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427069 Lyophilized TEX264 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414327 Transient overexpression lysate of testis expressed 264 (TEX264), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427069 Transient overexpression lysate of testis expressed 264 (TEX264), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300008 Recombinant protein of human testis expressed 264 (TEX264), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products