(NM_001297557) Rat Tagged ORF Clone

CAT#: RR215722

Oaz1 (myc-DDK-tagged) - Rat ornithine decarboxylase antizyme 1 (Oaz1), transcript variant 1

Change vector?

  • TrueORF®

USD 402


Availability*
2 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name (NM_001297557) Rat Tagged ORF Clone
Synonyms Oaz; ODC-Az; ODCAC
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RR215722 representing NM_001297557
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGCTTCTTAGTCAGCACAGCCGCGGCGGCTGCAGCAGCGAGAGTTCTAGGGTTGCCCTTCATTGCT
GTAGTAACCTGGGTCCGGGGCCTCGGTGGTGCTCCATGCCGCTTCTTAGTCAGCACAGCCGCGGCGGCTG
CAGCAGCGAGAGTTCTAGGGTTGCCCTTCATTGCTGTAGTAACCTGGGTCCGGGGCCTCGGTGGTGCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR215722 representing NM_001297557
Red=Cloning site Green=Tags(s)

MPLLSQHSRGGCSSESSRVALHCCSNLGPGPRWCSMPLLSQHSRGGCSSESSRVALHCCSNLGPGPRWCS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001297557
ORF Size 207 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001297557
RefSeq Size 1067
MW 7.4 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.