Ednra (NM_012550) Rat Tagged ORF Clone

CAT#: RR214158

Ednra (Myc-DDK-tagged ORF) - Rat endothelin receptor type A (Ednra), (10 ug)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Ednra (NM_012550) Rat Tagged ORF Clone
Symbol Ednra
Synonyms Endor; ET-A; ET-AR; Eta; RGD1559432
Vector pCMV6-Entry
Sequence Data
>RR214158 representing NM_012550
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTGTCCTTTGCTTTCTGGCGTCCTTTTGGCTGGCCCTGGTGGGAGGCGCAATCGCTGACAATGCTG
AGAGATACAGTGCTAATCTAAGCAGCCACGTGGAGGACTTCACCCCTTTTCCAGGGACAGAGTTCGACTT
TCTGGGCACCACCCTTCGACCCCCTAATTTGGCCCTGCCTAGCAATGGCTCAATGCATGGCTATTGCCCA
CAGCAGACAAAAATCACGACGGCTTTCAAATATATCAACACTGTGATATCCTGTACCATTTTCATCGTGG
GAATGGTGGGGAACGCCACTCTCCTAAGAATCATTTACCAAAACAAGTGTATGAGGAACGGCCCCAATGC
GCTCATAGCCAGCCTGGCCCTTGGAGACCTTATCTACGTGGTCATTGATCTCCCCATCAATGTGTTTAAG
CTGTTGGCGGGGCGCTGGCCTTTTGACCACAATGATTTTGGAGTGTTTCTCTGCAAGCTGTTCCCCTTTT
TGCAGAAGTCGTCCGTGGGCATCACTGTCCTGAATCTCTGCGCTCTCAGTGTGGACAGGTACAGAGCAGT
GGCTTCCTGGAGCCGGGTTCAAGGAATCGGGATCCCCTTGATTACCGCCATTGAAATTGTCTCCATCTGG
ATCCTTTCCTTTATCTTGGCCATCCCAGAAGCAATCGGCTTCGTCATGGTACCCTTCGAATACAAGGGCG
AGCAGCACAGGACCTGCATGCTCAACGCCACGACCAAGTTCATGGAGTTTTACCAAGACGTGAAGGACTG
GTGGCTCTTTGGATTCTACTTCTGCATGCCCTTGGTGTGCACAGCAATCTTCTATACCCTCATGACCTGT
GAGATGCTCAACAGAAGGAATGGGAGCTTGCGGATTGCCCTCAGCGAACACCTCAAGCAGCGTCGAGAGG
TGGCAAAGACCGTCTTCTGCTTGGTTGTCATCTTCGCCCTGTGCTGGTTCCCTCTTCACTTAAGCCGAAT
TTTGAAGAAAACCGTCTATGATGAGATGGATAAGAACCGGTGTGAACTGCTCAGCTTCTTGCTGCTCATG
GATTACATTGGCATTAACCTGGCAACCATGAACTCTTGCATAAACCCAATAGCTCTGTATTTTGTGAGCA
AGAAATTCAAAAATTGTTTTCAGTCATGCCTCTGTTGCTGTTGTCACCAGTCCAAAAGCCTCATGACCTC
GGTCCCCATGAATGGAACGAGTATCCAGTGGAAGAACCAGGAGCAGAACCACAACACAGAACGGAGCAGC
CACAAGGACAGCATGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR214158 representing NM_012550
Red=Cloning site Green=Tags(s)

MGVLCFLASFWLALVGGAIADNAERYSANLSSHVEDFTPFPGTEFDFLGTTLRPPNLALPSNGSMHGYCP
QQTKITTAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFK
LLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLITAIEIVSIW
ILSFILAIPEAIGFVMVPFEYKGEQHRTCMLNATTKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTC
EMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYDEMDKNRCELLSFLLLM
DYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCHQSKSLMTSVPMNGTSIQWKNQEQNHNTERSS
HKDSMN

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012550
ORF Size 1278 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012550.1, NM_012550.2, NP_036682
RefSeq Size 4595
RefSeq ORF 1281
Locus ID 24326
Cytogenetics 19q11
MW 48.3 kDa
Gene Summary binds endothelin 1 and induces an increase in intracellular calcium [RGD, Feb 2006]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and orthologous data. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)