Glutathione Peroxidase 3(GPX3) (NM_002084) Human Tagged ORF Clone

CAT#: RG207758

GPX3 (GFP-tagged) - Human glutathione peroxidase 3 (plasma) (GPX3), (10ug,) (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Glutathione Peroxidase 3(GPX3) (NM_002084) Human Tagged ORF Clone
Symbol GPX3
Synonyms GPx-P; GSHPx-3; GSHPx-P
Vector pCMV6-AC-GFP
Sequence Data
>RG207758 representing NM_002084
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCGGCTGCTGCAGGCGTCCTGCCTGCTTTCCCTGCTCCTGGCCGGCTTCGTCTCGCAGAGCCGGG
GACAAGAGAAGTCGAAGATGGACTGCCATGGTGGCATAAGTGGCACCATTTACGAGTACGGAGCCCTCAC
CATTGATGGGGAGGAGTACATCCCCTTCAAGCAGTATGCTGGCAAATACGTCCTCTTTGTCAACGTGGCC
AGCTACTGAGGCCTGACGGGCCAGTACATTGAACTGAATGCACTACAGGAAGAGCTTGCACCATTCGGTC
TGGTCATTCTGGGCTTTCCCTGCAACCAATTTGGAAAACAGGAACCAGGAGAGAACTCAGAGATCCTTCC
TACCCTCAAGTATGTCCGACCAGGTGGAGGCTTTGTCCCTAATTTCCAGCTCTTTGAGAAAGGGGATGTC
AATGGAGAGAAAGAGCAGAAATTCTACACTTTCCTAAAGAACTCCTGTCCTCCCACCTCGGAGCTCCTGG
GTACATCTGACCGCCTCTTCTGGGAACCCATGAAGGTTCACGACATCCGCTGGAACTTTGAGAAGTTCCT
GGTGGGGCCAGATGGTATACCCATCATGCGCTGGCACCACCGGACCACGGTCAGCAACGTCAAGATGGAC
ATCCTGTCCTACATGAGGCGGCAGGCAGCCCTGGGGGTCAAGAGGAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG207758 representing NM_002084
Red=Cloning site Green=Tags(s)

MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVA
SY*GLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDV
NGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMD
ILSYMRRQAALGVKRK

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_002084
ORF Size 678 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_002084.3, NP_002075
RefSeq Size 1779
RefSeq ORF 681
Locus ID 2878
Cytogenetics 5q33.1
Protein Families Secreted Protein, Druggable Genome
Protein Pathways Glutathione metabolism, Arachidonic acid metabolism
Gene Summary The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is secreted, and is abundantly found in plasma. Downregulation of expression of this gene by promoter hypermethylation has been observed in a wide spectrum of human malignancies, including thyroid cancer, hepatocellular carcinoma and chronic myeloid leukemia. This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)