APPL (APPL1) (NM_012096) Human Tagged ORF Clone

CAT#: RG206021

Reviews ()
Write a review
  • TrueORF®

APPL1 (GFP-tagged) - Human adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 (APPL1)


Product Datasheet for 'RG206021'


  "NM_012096" in other vectors (6)

Need a mutant or fragment? Switch to a different vector? Get a free quote.

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name APPL (APPL1) (NM_012096) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol APPL1
Synonyms APPL; DIP13alpha; MODY14
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG206021 representing NM_012096
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGGGATCGACAAGCTGCCCATCGAGGAGACGCTGGAGGACAGCCCGCAGACAAGGTCTTTACTGG
GTGTATTTGAAGAAGATGCCACAGCTATTTCCAACTATATGAACCAGTTGTATCAAGCTATGCATCGGAT
TTATGATGCACAGAATGAATTAAGTGCAGCAACACACCTGACCTCAAAACTTTTAAAAGAATATGAAAAA
CAGCGTTTTCCATTGGGAGGTGATGATGAAGTTATGAGCTCTACATTGCAACAGTTTTCAAAAGTTATAG
ATGAGCTTAGCTCTTGTCATGCAGTGCTTTCAACTCAACTTGCTGATGCCATGATGTTCCCCATTACCCA
GTTTAAAGAAAGAGATCTGAAAGAAATACTAACATTAAAGGAAGTATTTCAGATTGCAAGTAATGATCAT
GATGCTGCGATTAATAGATATAGCCGTTTATCAAAAAAAAGAGAAAATGACAAGGTGAAGTATGAAGTAA
CAGAAGATGTGTACACATCCAGAAAGAAACAACACCAGACCATGATGCATTATTTTTGTGCATTAAATAC
TCTTCAGTACAAGAAGAAAATAGCATTGTTAGAACCTCTACTTGGGTACATGCAAGCTCAGATAAGTTTC
TTTAAGATGGGTTCTGAAAATCTTAATGAACAACTGGAAGAATTTTTAGCTAATATTGGAACAAGCGTTC
AGAATGTTCGCAGGGAAATGGACAGTGATATAGAGACCATGCAACAGACAATAGAGGATTTGGAAGTAGC
CAGTGATCCCTTATATGTGCCTGACCCAGACCCCACCAAATTTCCTGTTAATCGAAATTTAACCCGAAAG
GCTGGATACCTTAATGCTAGGAATAAAACAGGCTTGGTGTCATCTACCTGGGACAGACAGTTTTACTTCA
CGCAGGGTGGAAATTTAATGAGTCAGGCCCGTGGGGATGTAGCAGGAGGCCTGGCCATGGACATAGACAA
CTGTTCAGTGATGGCTGTGGACTGTGAAGACAGACGATATTGTTTTCAGATCACCTCTTTCGATGGAAAA
AAATCTTCAATTTTGCAAGCAGAGAGTAAAAAAGATCATGAAGAGTGGATCTGTACAATAAACAACATAT
CTAAACAAATATACTTAAGTGAAAATCCAGAGGAAACTGCTGCACGAGTAAATCAATCAGCTCTGGAAGC
TGTCACTCCTTCCCCATCTTTCCAGCAGAGGCACGAGAGCCTGCGGCCAGCAGCAGGACAATCTCGGCCA
CCGACAGCTCGAACCAGCAGTTCAGGATCCTTAGGATCTGAGTCTACAAATTTGGCTGCCCTCTCTCTAG
ATTCTCTTGTTGCCCCAGACACCCCAATACAGTTTGACATAATTTCTCCTGTGTGTGAAGATCAGCCTGG
CCAGGCAAAAGCCTTTGGCCAGGGAGGCAGGCGTACAAATCCATTTGGAGAATCTGGAGGAAGTACAAAA
TCTGAAACTGAAGATTCTATTCTTCATCAGTTATTTATTGTCCGATTCCTTGGTTCAATGGAGGTGAAAT
CAGATGACCATCCAGATGTTGTTTATGAAACTATGCGCCAAATCTTAGCTGCCCGGGCCATCCATAACAT
CTTTCGTATGACAGAATCGCATTTATTAGTCACTTGTGACTGTTTAAAGTTAATTGATCCACAGACACAA
GTTACAAGGCTCACGTTTCCATTACCTTGTGTAGTTTTGTATGCTACACACCAGGAAAATAAGCGCCTTT
TTGGATTTGTTCTTCGGACATCAAGCGGGAGAAGTGAAAGTAATCTGTCATCAGTCTGCTATATATTTGA
GTCAAACAATGAGGGGGAAAAGATATGTGATTCTGTTGGACTGGCAAAACAGATAGCTTTGCATGCTGAA
CTGGATCGTAGGGCATCAGAAAAACAAAAAGAAATAGAGAGAGTAAAAGAGAAGCAACAGAAAGAACTCA
ATAAACAAAAACAGATTGAAAAGGACTTGGAAGAACAAAGTCGGTTGATAGCTGCTTCCAGTAGACCAAA
CCAAGCCAGTAGTGAGGGGCAGTTTGTTGTCCTTAGCAGTAGCCAGTCAGAAGAGAGTGATTTGGGAGAA
GGAGGAAAGAAGAGAGAATCAGAAGCA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG206021 representing NM_012096
Red=Cloning site Green=Tags(s)

MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEK
QRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILTLKEVFQIASNDH
DAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISF
FKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRK
AGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGK
KSSILQAESKKDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPAAGQSRP
PTARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTNPFGESGGSTK
SETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQ
VTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAE
LDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGE
GGKKRESEA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_012096
ORF Size 2127 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012096.2, NP_036228.1
RefSeq Size 6061
RefSeq ORF 2130
Locus ID 26060
Cytogenetics 3p14.3
Domains PH, PID
Protein Pathways Colorectal cancer, Pathways in cancer
Gene Summary The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A, DCC, AKT2, PIK3CA, adiponectin receptors, and proteins of the NuRD/MeCP1 complex. This protein is found associated with endosomal membranes, but can be released by EGF and translocated to the nucleus. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "APPL1"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


APPL1 mouse monoclonal antibody,clone OTI4B11
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools