APPL (APPL1) (NM_012096) Human Tagged ORF Clone

CAT#: RC206021

Reviews ()
Write a review

APPL1 (Myc-DDK-tagged)-Human adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 (APPL1)



  "NM_012096" in other vectors (6)

Reconstitution Protocol

USD 649.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "APPL1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol APPL1
Synonyms APPL; DIP13alpha; MODY14
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC206021 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGGGATCGACAAGCTGCCCATCGAGGAGACGCTGGAGGACAGCCCGCAGACAAGGTCTTTACTGG
GTGTATTTGAAGAAGATGCCACAGCTATTTCCAACTATATGAACCAGTTGTATCAAGCTATGCATCGGAT
TTATGATGCACAGAATGAATTAAGTGCAGCAACACACCTGACCTCAAAACTTTTAAAAGAATATGAAAAA
CAGCGTTTTCCATTGGGAGGTGATGATGAAGTTATGAGCTCTACATTGCAACAGTTTTCAAAAGTTATAG
ATGAGCTTAGCTCTTGTCATGCAGTGCTTTCAACTCAACTTGCTGATGCCATGATGTTCCCCATTACCCA
GTTTAAAGAAAGAGATCTGAAAGAAATACTAACATTAAAGGAAGTATTTCAGATTGCAAGTAATGATCAT
GATGCTGCGATTAATAGATATAGCCGTTTATCAAAAAAAAGAGAAAATGACAAGGTGAAGTATGAAGTAA
CAGAAGATGTGTACACATCCAGAAAGAAACAACACCAGACCATGATGCATTATTTTTGTGCATTAAATAC
TCTTCAGTACAAGAAGAAAATAGCATTGTTAGAACCTCTACTTGGGTACATGCAAGCTCAGATAAGTTTC
TTTAAGATGGGTTCTGAAAATCTTAATGAACAACTGGAAGAATTTTTAGCTAATATTGGAACAAGCGTTC
AGAATGTTCGCAGGGAAATGGACAGTGATATAGAGACCATGCAACAGACAATAGAGGATTTGGAAGTAGC
CAGTGATCCCTTATATGTGCCTGACCCAGACCCCACCAAATTTCCTGTTAATCGAAATTTAACCCGAAAG
GCTGGATACCTTAATGCTAGGAATAAAACAGGCTTGGTGTCATCTACCTGGGACAGACAGTTTTACTTCA
CGCAGGGTGGAAATTTAATGAGTCAGGCCCGTGGGGATGTAGCAGGAGGCCTGGCCATGGACATAGACAA
CTGTTCAGTGATGGCTGTGGACTGTGAAGACAGACGATATTGTTTTCAGATCACCTCTTTCGATGGAAAA
AAATCTTCAATTTTGCAAGCAGAGAGTAAAAAAGATCATGAAGAGTGGATCTGTACAATAAACAACATAT
CTAAACAAATATACTTAAGTGAAAATCCAGAGGAAACTGCTGCACGAGTAAATCAATCAGCTCTGGAAGC
TGTCACTCCTTCCCCATCTTTCCAGCAGAGGCACGAGAGCCTGCGGCCAGCAGCAGGACAATCTCGGCCA
CCGACAGCTCGAACCAGCAGTTCAGGATCCTTAGGATCTGAGTCTACAAATTTGGCTGCCCTCTCTCTAG
ATTCTCTTGTTGCCCCAGACACCCCAATACAGTTTGACATAATTTCTCCTGTGTGTGAAGATCAGCCTGG
CCAGGCAAAAGCCTTTGGCCAGGGAGGCAGGCGTACAAATCCATTTGGAGAATCTGGAGGAAGTACAAAA
TCTGAAACTGAAGATTCTATTCTTCATCAGTTATTTATTGTCCGATTCCTTGGTTCAATGGAGGTGAAAT
CAGATGACCATCCAGATGTTGTTTATGAAACTATGCGCCAAATCTTAGCTGCCCGGGCCATCCATAACAT
CTTTCGTATGACAGAATCGCATTTATTAGTCACTTGTGACTGTTTAAAGTTAATTGATCCACAGACACAA
GTTACAAGGCTCACGTTTCCATTACCTTGTGTAGTTTTGTATGCTACACACCAGGAAAATAAGCGCCTTT
TTGGATTTGTTCTTCGGACATCAAGCGGGAGAAGTGAAAGTAATCTGTCATCAGTCTGCTATATATTTGA
GTCAAACAATGAGGGGGAAAAGATATGTGATTCTGTTGGACTGGCAAAACAGATAGCTTTGCATGCTGAA
CTGGATCGTAGGGCATCAGAAAAACAAAAAGAAATAGAGAGAGTAAAAGAGAAGCAACAGAAAGAACTCA
ATAAACAAAAACAGATTGAAAAGGACTTGGAAGAACAAAGTCGGTTGATAGCTGCTTCCAGTAGACCAAA
CCAAGCCAGTAGTGAGGGGCAGTTTGTTGTCCTTAGCAGTAGCCAGTCAGAAGAGAGTGATTTGGGAGAA
GGAGGAAAGAAGAGAGAATCAGAAGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC206021 protein sequence
Red=Cloning site Green=Tags(s)

MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEK
QRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILTLKEVFQIASNDH
DAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISF
FKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRK
AGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGK
KSSILQAESKKDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPAAGQSRP
PTARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTNPFGESGGSTK
SETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQ
VTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAE
LDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGE
GGKKRESEA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_012096
ORF Size 2127 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012096.3
RefSeq Size 6061 bp
RefSeq ORF 2130 bp
Locus ID 26060
UniProt ID Q9UKG1
Cytogenetics 3p14.3
Domains PH, PID
Protein Pathways Colorectal cancer, Pathways in cancer
MW 79.7 kDa
Gene Summary The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A, DCC, AKT2, PIK3CA, adiponectin receptors, and proteins of the NuRD/MeCP1 complex. This protein is found associated with endosomal membranes, but can be released by EGF and translocated to the nucleus. [provided by RefSeq, Jul 2008]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.