APOBEC3C (NM_014508) Human Tagged ORF Clone

CAT#: RG203971

  • TrueORF®

APOBEC3C (tGFP-tagged) - Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C)



  "NM_014508" in other vectors (7)

Reconstitution Protocol

USD 650.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "APOBEC3C"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol APOBEC3C
Synonyms A3C; APOBEC1L; ARDC2; ARDC4; ARP5; bK150C2.3; PBI
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG203971 representing NM_014508
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATCCACAGATCAGAAACCCGATGAAGGCAATGTATCCAGGCACATTCTACTTCCAATTTAAAAACC
TATGGGAAGCCAACGATCGGGACGAAACTTGGCTGTGCTTCACCGTGGAAGGTATAAAGCGCCGCTCAGT
TGTCTCCTGGAAGACGGGCGTCTTCCGAAACCAGGTGGATTCTGAGACCCATTGTCATGCAGAAAGGTGC
TTCCTCTCTTGGTTCTGCGACGACATACTGTCTCCTAACACAAAGTACCAGGTCACCTGGTACACATCTT
GGAGCCCTTGCCCAGACTGTGCAGGGGAGGTGGCCGAGTTCCTGGCCAGGCACAGCAACGTGAATCTCAC
CATCTTCACCGCCCGCCTCTACTACTTCCAGTATCCATGTTACCAGGAGGGGCTCCGCAGCCTGAGTCAG
GAAGGGGTCGCTGTGGAGATCATGGACTATGAAGATTTTAAATATTGTTGGGAAAACTTTGTGTACAATG
ATAATGAGCCATTCAAGCCTTGGAAGGGATTAAAAACCAACTTTCGACTTCTGAAAAGAAGGCTACGGGA
GAGTCTCCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG203971 representing NM_014508
Red=Cloning site Green=Tags(s)

MNPQIRNPMKAMYPGTFYFQFKNLWEANDRDETWLCFTVEGIKRRSVVSWKTGVFRNQVDSETHCHAERC
FLSWFCDDILSPNTKYQVTWYTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQ
EGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014508
ORF Size 570 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014508.1
RefSeq Size 1127 bp
RefSeq ORF 573 bp
Locus ID 27350
UniProt ID Q9NRW3
Cytogenetics 22q13.1
Gene Summary This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.