APOBEC3C (NM_014508) Human Tagged ORF Clone

CAT#: RC203971

Reviews ()
Write a review

APOBEC3C (Myc-DDK-tagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C)



  "NM_014508" in other vectors (7)

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name APOBEC3C (NM_014508) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol APOBEC3C
Synonyms A3C; APOBEC1L; ARDC2; ARDC4; ARP5; bK150C2.3; PBI
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC203971 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATCCACAGATCAGAAACCCGATGAAGGCAATGTATCCAGGCACATTCTACTTCCAATTTAAAAACC
TATGGGAAGCCAACGATCGGGACGAAACTTGGCTGTGCTTCACCGTGGAAGGTATAAAGCGCCGCTCAGT
TGTCTCCTGGAAGACGGGCGTCTTCCGAAACCAGGTGGATTCTGAGACCCATTGTCATGCAGAAAGGTGC
TTCCTCTCTTGGTTCTGCGACGACATACTGTCTCCTAACACAAAGTACCAGGTCACCTGGTACACATCTT
GGAGCCCTTGCCCAGACTGTGCAGGGGAGGTGGCCGAGTTCCTGGCCAGGCACAGCAACGTGAATCTCAC
CATCTTCACCGCCCGCCTCTACTACTTCCAGTATCCATGTTACCAGGAGGGGCTCCGCAGCCTGAGTCAG
GAAGGGGTCGCTGTGGAGATCATGGACTATGAAGATTTTAAATATTGTTGGGAAAACTTTGTGTACAATG
ATAATGAGCCATTCAAGCCTTGGAAGGGATTAAAAACCAACTTTCGACTTCTGAAAAGAAGGCTACGGGA
GAGTCTCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203971 protein sequence
Red=Cloning site Green=Tags(s)

MNPQIRNPMKAMYPGTFYFQFKNLWEANDRDETWLCFTVEGIKRRSVVSWKTGVFRNQVDSETHCHAERC
FLSWFCDDILSPNTKYQVTWYTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQ
EGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014508
ORF Size 570 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014508.1, NM_014508.2, NP_055323.2
RefSeq Size 1127 bp
RefSeq ORF 573 bp
Locus ID 27350
Cytogenetics 22q13.1
MW 22.8 kDa
Gene Summary This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "APOBEC3C"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-APOBEC3C Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools