APOBEC3C (NM_014508) Human Tagged ORF Clone
CAT#: RC203971
APOBEC3C (Myc-DDK-tagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C)
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
"NM_014508" in other vectors (7)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | APOBEC3C |
Synonyms | A3C; APOBEC1L; ARDC2; ARDC4; ARP5; bK150C2.3; PBI |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC203971 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAATCCACAGATCAGAAACCCGATGAAGGCAATGTATCCAGGCACATTCTACTTCCAATTTAAAAACC TATGGGAAGCCAACGATCGGGACGAAACTTGGCTGTGCTTCACCGTGGAAGGTATAAAGCGCCGCTCAGT TGTCTCCTGGAAGACGGGCGTCTTCCGAAACCAGGTGGATTCTGAGACCCATTGTCATGCAGAAAGGTGC TTCCTCTCTTGGTTCTGCGACGACATACTGTCTCCTAACACAAAGTACCAGGTCACCTGGTACACATCTT GGAGCCCTTGCCCAGACTGTGCAGGGGAGGTGGCCGAGTTCCTGGCCAGGCACAGCAACGTGAATCTCAC CATCTTCACCGCCCGCCTCTACTACTTCCAGTATCCATGTTACCAGGAGGGGCTCCGCAGCCTGAGTCAG GAAGGGGTCGCTGTGGAGATCATGGACTATGAAGATTTTAAATATTGTTGGGAAAACTTTGTGTACAATG ATAATGAGCCATTCAAGCCTTGGAAGGGATTAAAAACCAACTTTCGACTTCTGAAAAGAAGGCTACGGGA GAGTCTCCAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203971 protein sequence
Red=Cloning site Green=Tags(s) MNPQIRNPMKAMYPGTFYFQFKNLWEANDRDETWLCFTVEGIKRRSVVSWKTGVFRNQVDSETHCHAERC FLSWFCDDILSPNTKYQVTWYTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQ EGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_014508 |
ORF Size | 570 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_014508.1 |
RefSeq Size | 1127 bp |
RefSeq ORF | 573 bp |
Locus ID | 27350 |
UniProt ID | Q9NRW3 |
Cytogenetics | 22q13.1 |
MW | 22.8 kDa |
Gene Summary | This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC203971L1 | Lenti ORF clone of Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C), Myc-DDK-tagged |
USD 750.00 |
|
RC203971L2 | Lenti ORF clone of Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C), mGFP tagged |
USD 750.00 |
|
RC203971L3 | Lenti ORF clone of Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C), Myc-DDK-tagged |
USD 750.00 |
|
RC203971L4 | Lenti ORF clone of Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C), mGFP tagged |
USD 750.00 |
|
RG203971 | APOBEC3C (tGFP-tagged) - Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C) |
USD 650.00 |
|
SC309155 | APOBEC3C (untagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C) |
USD 480.00 |
|
SC320908 | APOBEC3C (untagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3C (APOBEC3C) |
USD 450.00 |
{0} Product Review(s)
Be the first one to submit a review