C11orf73 (HIKESHI) (NM_016401) Human Tagged ORF Clone

CAT#: RG200866

  • TrueORF®

C11orf73 (tGFP-tagged) - Human chromosome 11 open reading frame 73 (C11orf73), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_016401" in other vectors (4)

Reconstitution Protocol

USD 500.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


Rabbit Polyclonal Anti-C11orf73 Antibody - middle region
    • 100 ul

USD 539.00

Other products for "C11orf73"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol C11orf73
Synonyms C11orf73; HLD13; HSPC138; HSPC179; L7RN6; OPI10
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG200866 representing NM_016401
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTGGCTGCTTGGTGGCGGGGAGGCTGGTGCAAACAGCTGCACAGCAAGTGGCAGAGGATAAATTTG
TTTTTGACTTACCTGATTATGAAAGTATCAACCATGTTGTGGTTTTTATGCTGGGAACAATCCCATTTCC
TGAGGGAATGGGAGGATCTGTCTACTTTTCTTATCCTGATTCAAATGGAATGCCAGTATGGCAACTCCTA
GGATTTGTCACGAATGGGAAGCCAAGTGCCATCTTCAAAATTTCAGGTCTTAAATCTGGAGAAGGAAGCC
AACATCCTTTTGGAGCCATGAATATTGTCCGAACTCCATCTGTTGCTCAGATTGGAATTTCAGTGGAATT
ATTAGACAGTATGGCTCAGCAGACTCCTGTAGGTAATGCTGCTGTATCCTCAGTTGACTCATTCACTCAG
TTCACACAAAAGATGTTGGACAATTTCTACAATTTTGCTTCATCATTTGCTGTCTCTCAGGCCCAGATGA
CACCAAGCCCATCTGAAATGTTCATTCCGGCAAATGTGGTTCTGAAATGGTATGAAAACTTTCAAAGACG
ACTAGCACAGAACCCTCTCTTTTGGAAAACA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG200866 representing NM_016401
Red=Cloning site Green=Tags(s)

MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMPVWQLL
GFVTNGKPSAIFKISGLKSGEGSQHPFGAMNIVRTPSVAQIGISVELLDSMAQQTPVGNAAVSSVDSFTQ
FTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWKT

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_016401
ORF Size 591 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016401.4
RefSeq Size 1152 bp
RefSeq ORF 594 bp
Locus ID 51501
UniProt ID Q53FT3
Cytogenetics 11q14.2
Gene Summary This gene encodes an evolutionarily conserved nuclear transport receptor that mediates heat-shock-induced nuclear import of 70 kDa heat-shock proteins (Hsp70s) through interactions with FG-nucleoporins. The protein mediates transport of the ATP form but not the ADP form of Hsp70 proteins under conditions of heat shock stress. Structural analyses demonstrate that the protein forms an asymmetric homodimer and that the N-terminal domain consists of a jelly-roll/beta-sandwich fold structure that contains hydrophobic pockets involved in FG-nucleoporin recognition. Reduction of RNA expression levels in HeLa cells using small interfering RNAs results in inhibition of heat shock-induced nuclear accumulation of Hsp70s, indicating a role for this gene in regulation of Hsp70 nuclear import during heat shock stress. [provided by RefSeq, Apr 2016]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.