ATG5(ATG5) (NM_001286111) Human Tagged ORF Clone

CAT#: RC235557

ATG5 (myc-DDK-tagged) - Human autophagy related 5 (ATG5), transcript variant 5

Change vector?

  • TrueORF®

USD 402


Availability*
2 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ATG5(ATG5) (NM_001286111) Human Tagged ORF Clone
Symbol ATG5
Synonyms APG5; APG5-LIKE; APG5L; ASP; hAPG5
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC235557 representing NM_001286111
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAGATGACAAAGATGTGCTTCGAGATGTGTGGTTTGGACGAATTCCAACTTGTTTCACGCTATATC
AGGATGAGATAACTGAAAGGGAAGCAGAACCATACTATACAGATTTGACCAGTTTTGGGCCATCAATCGG
AAACTCATGGAATATCCTGCAGAAGAAAATGGATTTCGTTATATCCCCTTTAGAATATATCAGACAACGA
CTGAAAGACCTTTCATTCAGAAGCTGTTTCGTCCTGTGGCTGCAGATGGACAGTTGCACACAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC235557 representing NM_001286111
Red=Cloning site Green=Tags(s)

MTDDKDVLRDVWFGRIPTCFTLYQDEITEREAEPYYTDLTSFGPSIGNSWNILQKKMDFVISPLEYIRQR
LKDLSFRSCFVLWLQMDSCTH

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001286111
ORF Size 273 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001286111.1, NP_001273040
RefSeq Size 2890
RefSeq ORF 276
Locus ID 9474
Cytogenetics 6q21
Protein Families Druggable Genome
Protein Pathways Regulation of autophagy, RIG-I-like receptor signaling pathway
MW 11.3 kDa
Gene Summary May play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity. Plays a crucial role in IFN-gamma-induced autophagic cell death by interacting with FADD. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations