DAXX (NM_001141969) Human Tagged ORF Clone

CAT#: RC226603

Reviews ()
Write a review

DAXX (Myc-DDK-tagged)-Human death-domain associated protein (DAXX), transcript variant 1



  "NM_001141969" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,016.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "DAXX"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DAXX
Synonyms BING2; DAP6; EAP1; SMIM40
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC226603 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACCGCTAACAGCATCATCGTGCTGGATGATGATGACGAAGATGAAGCAGCTGCTCAGCCAGGGC
CCTCCCACCCACTCCCCAATGCGGCCTCACCTGGGGCAGAAGCCCCTAGCTCCTCTGAGCCTCATGGGGC
CAGAGGAAGCAGTAGTTCGGGCGGCAAGAAATGCTACAAGCTGGAGAATGAGAAGCTGTTCGAAGAGTTC
CTTGAACTTTGTAAGATGCAGACAGCAGACCACCCTGAGGTGGTCCCATTCCTCTATAACCGGCAGCAAC
GTGCCCACTCTCTGTTTTTGGCCTCGGCGGAGTTCTGCAACATCCTCTCTAGGGTCCTGTCTCGGGCCCG
GAGCCGGCCAGCCAAGCTCTATGTCTACATCAATGAGCTCTGCACTGTTCTCAAGGCCCACTCAGCCAAA
AAGAAGCTGAACTTGGCCCCTGCCGCCACCACCTCCAATGAGCCCTCTGGGAATAACCCTCCCACACACC
TCTCCTTGGACCCCACAAATGCTGAAAACACTGCCTCTCAGTCTCCAAGGACCCGTGGTTCCCGGCGGCA
GATCCAGCGTTTGGAGCAGCTGCTGGCGCTCTATGTGGCAGAGATCCGGCGGCTGCAGGAAAAGGAGTTG
GATCTCTCAGAATTGGATGACCCAGACTCCGCATACCTGCAGGAGGCACGGTTGAAGCGTAAGCTGATCC
GCCTCTTTGGGCGACTATGTGAGCTGAAAGACTGCTCTTCACTGACCGGCCGTGTCATAGAGCAGCGCAT
CCCCTACCGTGGCACCCGCTACCCAGAGGTTAACAGGCGCATTGAGCGGCTCATCAACAAGCCAGGGCCT
GATACCTTCCCTGACTATGGGGATGTGCTTCGGGCTGTAGAGAAGGCAGCTGCCCGACACAGCCTTGGCC
TCCCCCGACAGCAGCTCCAGCTCATGGCTCAGGATGCCTTCCGAGATGTGGGCATCAGGTTACAGGAGCG
ACGTCACCTCGATCTCATCTACAACTTTGGCTGCCACCTCACAGATGACTATAGGCCAGGCGTTGACCCT
GCACTATCAGATCCTGTGTTGGCCCGGCGCCTTCGGGAAAACCGGAGTTTGGCCATGAGTCGGCTGGATG
AGGTCATCTCCAAATACGCAATGTTGCAAGACAAAAGTGAGGAGGGCGAGAGAAAAAAGAGAAGAGCTCG
GCTCCAAGGCACCTCTTCCCACTCTGCAGACACCCCCGAAGCCTCCTTGGATTCTGGTGAGGGCCCTAGT
GGAATGGCATCCCAGGGGTGCCCTTCTGCCTCCAGAGCTGAGACAGATGACGAAGACGATGAGGAGAGTG
ATGAGGAAGAGGAGGAGGAGGAGGAAGAAGAAGAGGAGGAGGCCACAGATTCTGAAGAGGAGGAGGATCT
GGAACAGATGCAGGAGGGTCAGGAGGATGATGAAGAGGAGGACGAAGAGGAAGAAGCAGCAGCAGGTAAA
GATGGAGACAAGAGCCCCATGTCCTCACTACAGATCTCCAATGAAAAGAACCTGGAACCTGGCAAACAGA
TCAGCAGATCTTCAGGGGAGCAGCAAAACAAAGGACGCATAGTGTCACCATCGTTACTGTCAGAAGAACC
CCTGGCCCCCTCCAGCATAGATGCTGAAAGCAATGGAGAACAGCCTGAGGAGCTGACCCTGGAGGAAGAA
AGCCCTGTGTCTCAGCTCTTTGAGCTAGAGATTGAAGCTTTGCCCCTGGATACCCCTTCCTCTGTGGAGA
CGGACATTTCCTCTTCCAGGAAGCAATCAGAGGAGCCCTTCACCACTGTCTTAGAGAATGGAGCAGGCAT
GGTCTCTTCTACTTCCTTCAATGGAGGCGTCTCTCCTCACAACTGGGGAGATTCTGGTCCCCCCTGCAAA
AAATCTCGGAAGGAGAAGAAGCAAACAGGATCAGGGCCATTAGGAAACAGCTATGTGGAAAGGCAAAGGT
CAGTGCATGAGAAGAATGGGAAAAAGATATGTACCCTGCCCAGCCCACCTTCCCCCTTGGCTTCCTTGGC
CCCAGTTGCTGATTCCTCCACGAGGGTGGACTCTCCCAGCCATGGCCTGGTGACCAGCTCCCTCTGCATC
CCTTCTCCAGCCCGGCTGTCCCAAACCCCCCATTCACAGCCTCCTCGGCCTGGTACTTGCAAGACAAGTG
TGGCCACACAATGCGATCCAGAAGAGATCATCGTGCTCTCAGACTCTGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC226603 protein sequence
Red=Cloning site Green=Tags(s)

MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEF
LELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAK
KKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKEL
DLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGP
DTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDP
ALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPS
GMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGK
DGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEE
SPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCK
KSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCI
PSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001141969
ORF Size 2220 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001141969.1, NP_001135441.1
RefSeq Size 2632 bp
RefSeq ORF 2223 bp
Locus ID 1616
UniProt ID Q9UER7
Cytogenetics 6p21.32
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Protein Pathways Amyotrophic lateral sclerosis (ALS), MAPK signaling pathway
MW 81.4 kDa
Gene Summary This gene encodes a multifunctional protein that resides in multiple locations in the nucleus and in the cytoplasm. It interacts with a wide variety of proteins, such as apoptosis antigen Fas, centromere protein C, and transcription factor erythroblastosis virus E26 oncogene homolog 1. In the nucleus, the encoded protein functions as a potent transcription repressor that binds to sumoylated transcription factors. Its repression can be relieved by the sequestration of this protein into promyelocytic leukemia nuclear bodies or nucleoli. This protein also associates with centromeres in G2 phase. In the cytoplasm, the encoded protein may function to regulate apoptosis. The subcellular localization and function of this protein are modulated by post-translational modifications, including sumoylation, phosphorylation and polyubiquitination. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2008]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.