nkx6.1 (NKX6-1) (NM_006168) Human Tagged ORF Clone

CAT#: RC224762

Reviews ()
Write a review

NKX6 (Myc-DDK-tagged)-Human NK6 homeobox 1 (NKX6-1)



Reconstitution Protocol

USD 686.00

In Stock*

Size
    • 10 ug

Product images

Other products for "NKX6-1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NKX6-1
Synonyms NKX6.1; NKX6A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC224762 representing NM_006168
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTAGCGGTGGGGGCAATGGAGGGCACCCGGCAGAGCGCATTCCTGCTCAGCAGCCCTCCCCTGGCCG
CCCTGCACAGCATGGCCGAGATGAAGACCCCGCTGTACCCTGCCGCGTATCCCCCGCTGCCTGCCGGCCC
CCCCTCCTCCTCGTCCTCGTCGTCGTCCTCCTCGTCGCCCTCCCCGCCTCTGGGCACCCACAACCCAGGC
GGCCTGAAGCCCCCGGCCACGGGGGGGCTCTCATCCCTCGGCAGCCCCCCGCAGCAGCTCTCGGCCGCCA
CCCCACACGGCATCAACGATATCCTGAGCCGGCCCTCCATGCCCGTGGCCTCGGGGGCCGCCCTGCCCTC
CGCCTCGCCCTCCGGTTCCTCCTCCTCCTCTTCCTCGTCCGCCTCTGCCTCCTCCGCCTCTGCCGCCGCC
GCGGCTGCTGCCGCGGCCGCAGCCGCCGCCTCATCCCCGGCGGGGCTGCTGGCCGGACTGCCACGCTTTA
GCAGCCTGAGCCCGCCGCCGCCGCCGCCCGGGCTCTACTTCAGCCCCAGCGCCGCGGCCGTGGCCGCCGT
GGGCCGGTACCCCAAGCCGCTGGCTGAGCTGCCTGGCCGGACGCCCATCTTCTGGCCCGGAGTGATGCAG
AGCCCGCCCTGGAGGGACGCACGCCTGGCCTGTACCCCTCATCAAGGATCCATTTTGTTGGACAAAGACG
GGAAGAGAAAACACACGAGACCCACTTTTTCCGGACAGCAGATCTTCGCCCTGGAGAAGACTTTCGAACA
AACAAAATACTTGGCGGGGCCCGAGAGGGCTCGTTTGGCCTATTCGTTGGGGATGACAGAGAGTCAGGTC
AAGGTCTGGTTCCAGAACCGCCGGACCAAGTGGAGGAAGAAGCACGCTGCCGAGATGGCCACGGCCAAGA
AGAAGCAGGACTCGGAGACAGAGCGCCTCAAGGGGGCCTCGGAGAACGAGGAAGAGGACGACGACTACAA
TAAGCCTCTGGATCCCAACTCGGACGACGAGAAAATCACGCAGCTGTTGAAGAAGCACAAGTCCAGCAGC
GGCGGCGGCGGCGGCCTCCTACTGCACGCGTCCGAGCCGGAGAGCTCATCC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC224762 representing NM_006168
Red=Cloning site Green=Tags(s)

MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPSSSSSSSSSSSPSPPLGTHNPG
GLKPPATGGLSSLGSPPQQLSAATPHGINDILSRPSMPVASGAALPSASPSGSSSSSSSSASASSASAAA
AAAAAAAAAASSPAGLLAGLPRFSSLSPPPPPPGLYFSPSAAAVAAVGRYPKPLAELPGRTPIFWPGVMQ
SPPWRDARLACTPHQGSILLDKDGKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQV
KVWFQNRRTKWRKKHAAEMATAKKKQDSETERLKGASENEEEDDDYNKPLDPNSDDEKITQLLKKHKSSS
GGGGGLLLHASEPESSS

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006168
ORF Size 1101 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006168.2, NP_006159.2
RefSeq Size 1116 bp
RefSeq ORF 1104 bp
Locus ID 4825
UniProt ID P78426
Cytogenetics 4q21.23
Protein Families Transcription Factors
Protein Pathways Maturity onset diabetes of the young
MW 37.7 kDa
Gene Summary In the pancreas, NKX6.1 is required for the development of beta cells and is a potent bifunctional transcription regulator that binds to AT-rich sequences within the promoter region of target genes Iype et al. (2004) [PubMed 15056733].[supplied by OMIM, Mar 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.