BLOC1S1 (NM_001487) Human Tagged ORF Clone

CAT#: RC224412

BLOC1S1 (Myc-DDK-tagged)-Human biogenesis of lysosomal organelles complex-1, subunit 1 (BLOC1S1), transcript variant 1



  "NM_001487" in other vectors (6)

Reconstitution Protocol

USD 150.00

USD 225.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "BLOC1S1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BLOC1S1
Synonyms BLOS1; BORCS1; GCN5L1; MICoA; RT14
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC224412 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTCCCGCCTCCTAAAAGAACACCAGGCCAAGCAGAATGAACGCAAGGAGCTGCAGGAAAAGAGGA
GGCGAGAGGCTATCACTGCAGCGACCTGCCTGACAGAAGCTTTGGTGGATCACCTCAATGTGGGTGTGGC
CCAGGCCTACATGAACCAGAGAAAGCTGGACCATGAGGTGAAGACCCTACAGGTCCAGGCTGCCCAATTT
GCCAAGCAGACAGGCCAGTGGATCGGAATGGTGGAGAACTTCAACCAGGCACTCAAGGAAATTGGGGATG
TGGAGAACTGGGCTCGGAGCATCGAGCTGGACATGCGCACCATTGCCACTGCACTGGAATATGTCTACAA
AGGGCAGCTGCAGTCTGCCCCTTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC224412 protein sequence
Red=Cloning site Green=Tags(s)

MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQF
AKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001487
ORF Size 375 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001487.2
RefSeq Size 590 bp
RefSeq ORF 462 bp
Locus ID 2647
UniProt ID P78537
Cytogenetics 12q13.2
MW 14.3 kDa
Gene Summary BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules (Starcevic and Dell'Angelica, 2004 [PubMed 15102850]).[supplied by OMIM, Mar 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.