EMX2 (NM_004098) Human Tagged ORF Clone

CAT#: RC222758

EMX2 (Myc-DDK-tagged)-Human empty spiracles homeobox 2 (EMX2), transcript variant 1

Clone Modification / Custom Cloning Service

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name EMX2 (NM_004098) Human Tagged ORF Clone
Symbol EMX2
Synonyms OTTHUMP00000020578; empty spiracles homolog 2; empty spiracles homeobox 2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC222758 representing NM_004098
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCCAGCCGGCGCCCAAGCGCTGCTTCACCATCGAGTCGCTGGTGGCCAAGGACAGTCCCCTGCCCG
CCTCGCGCTCCGAGGACCCCATCCGTCCCGCGGCACTCAGCTACGCTAACTCCAGCCCCATAAATCCGTT
CCTCAACGGCTTCCACTCGGCCGCCGCCGCCGCCGCCGGTAGGGGCGTCTACTCCAACCCGGACTTGGTG
TTCGCCGAGGCGGTCTCGCACCCGCCCAACCCCGCCGTGCCAGTGCACCCGGTGCCGCCGCCGCACGCCC
TGGCCGCCCACCCCCTACCCTCCTCGCACTCGCCACACCCCCTATTCGCCTCGCAGCAGCGGGATCCGTC
CACCTTCTACCCCTGGCTCATCCACCGCTACCGATATCTGGGTCATCGCTTCCAAGGGAACGACACTAGC
CCCGAGAGTTTCCTTTTGCACAACGCGCTGGCCCGAAAGCCCAAGCGGATCCGAACCGCCTTCTCCCCGT
CCCAGCTTCTAAGGCTGGAACACGCCTTTGAGAAGAATCACTACGTGGTGGGCGCCGAAAGGAAGCAGCT
GGCACACAGCCTCAGCCTCACGGAAACTCAGGTAAAAGTATGGTTTCAGAACCGAAGAACAAAGTTCAAA
AGGCAGAAGCTGGAGGAAGAAGGCTCAGATTCGCAACAAAAGAAAAAAGGGACGCACCATATTAACCGGT
GGAGAATCGCCACCAAGCAGGCGAGTCCGGAGGAAATAGACGTGACCTCAGATGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC222758 representing NM_004098
Red=Cloning site Green=Tags(s)

MFQPAPKRCFTIESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRGVYSNPDLV
FAEAVSHPPNPAVPVHPVPPPHALAAHPLPSSHSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTS
PESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFK
RQKLEEEGSDSQQKKKGTHHINRWRIATKQASPEEIDVTSDD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004098
ORF Size 756 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_004098.1, NM_004098.2, NM_004098.3, NP_004089
RefSeq Size 2907
RefSeq ORF 759
Locus ID 2018
Cytogenetics 10q26.11
Protein Families Druggable Genome
MW 28.1 kDa
Gene Summary This gene encodes a homeobox-containing transcription factor that is the homolog to the 'empty spiracles' gene in Drosophila. Research on this gene in humans has focused on its expression in three tissues: dorsal telencephalon, olfactory neuroepithelium, and urogenetial system. It is expressed in the dorsal telencephalon during development in a low rostral-lateral to high caudal-medial gradient and is proposed to pattern the neocortex into defined functional areas. It is also expressed in embryonic and adult olfactory neuroepithelia where it complexes with eukaryotic translation initiation factor 4E (eIF4E) and possibly regulates mRNA transport or translation. In the developing urogenital system, it is expressed in epithelial tissues and is negatively regulated by HOXA10. Alternative splicing results in multiple transcript variants encoding distinct proteins.[provided by RefSeq, Sep 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations