Glucose Transporter GLUT1(SLC2A1) (NM_006516) Human Tagged ORF Clone

CAT#: RC222696

SLC2A1 (Myc-DDK-tagged)-Human solute carrier family 2 (facilitated glucose transporter), member 1 (SLC2A1)

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 3 publications.

Product images

Specifications

Product Data
Product Name Glucose Transporter GLUT1(SLC2A1) (NM_006516) Human Tagged ORF Clone
Symbol SLC2A1
Synonyms CSE; DYT17; DYT18; DYT9; EIG12; GLUT; GLUT-1; GLUT1; GLUT1DS; HTLVR; PED; SDCHCN
Vector pCMV6-Entry
Sequence Data
>RC222696 representing NM_006516
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCCAGCAGCAAGAAGCTGACGGGTCGCCTCATGCTGGCCGTGGGAGGAGCAGTGCTTGGCTCCC
TGCAGTTTGGCTACAACACTGGAGTCATCAATGCCCCCCAGAAGGTGATCGAGGAGTTCTACAACCAGAC
ATGGGTCCACCGCTATGGGGAGAGCATCCTGCCCACCACGCTCACCACGCTCTGGTCCCTCTCAGTGGCC
ATCTTTTCTGTTGGGGGCATGATTGGCTCCTTCTCTGTGGGCCTTTTCGTTAACCGCTTTGGCCGGCGGA
ATTCAATGCTGATGATGAACCTGCTGGCCTTCGTGTCCGCCGTGCTCATGGGCTTCTCGAAACTGGGCAA
GTCCTTTGAGATGCTGATCCTGGGCCGCTTCATCATCGGTGTGTACTGCGGCCTGACCACAGGCTTCGTG
CCCATGTATGTGGGTGAAGTGTCACCCACAGCCCTTCGTGGGGCCCTGGGCACCCTGCACCAGCTGGGCA
TCGTCGTCGGCATCCTCATCGCCCAGGTGTTCGGCCTGGACTCCATCATGGGCAACAAGGACCTGTGGCC
CCTGCTGCTGAGCATCATCTTCATCCCGGCCCTGCTGCAGTGCATCGTGCTGCCCTTCTGCCCCGAGAGT
CCCCGCTTCCTGCTCATCAACCGCAACGAGGAGAACCGGGCCAAGAGTGTGCTAAAGAAGCTGCGCGGGA
CAGCTGACGTGACCCATGACCTGCAGGAGATGAAGGAAGAGAGTCGGCAGATGATGCGGGAGAAGAAGGT
CACCATCCTGGAGCTGTTCCGCTCCCCCGCCTACCGCCAGCCCATCCTCATCGCTGTGGTGCTGCAGCTG
TCCCAGCAGCTGTCTGGCATCAACGCTGTCTTCTATTACTCCACGAGCATCTTCGAGAAGGCGGGGGTGC
AGCAGCCTGTGTATGCCACCATTGGCTCCGGTATCGTCAACACGGCCTTCACTGTCGTGTCGCTGTTTGT
GGTGGAGCGAGCAGGCCGGCGGACCCTGCACCTCATAGGCCTCGCTGGCATGGCGGGTTGTGCCATACTC
ATGACCATCGCGCTAGCACTGCTGGAGCAGCTACCCTGGATGTCCTATCTGAGCATCGTGGCCATCTTTG
GCTTTGTGGCCTTCTTTGAAGTGGGTCCTGGCCCCATCCCATGGTTCATCGTGGCTGAACTCTTCAGCCA
GGGTCCACGTCCAGCTGCCATTGCCGTTGCAGGCTTCTCCAACTGGACCTCAAATTTCATTGTGGGCATG
TGCTTCCAGTATGTGGAGCAACTGTGTGGTCCCTACGTCTTCATCATCTTCACTGTGCTCCTGGTTCTGT
TCTTCATCTTCACCTACTTCAAAGTTCCTGAGACTAAAGGCCGGACCTTCGATGAGATCGCTTCCGGCTT
CCGGCAGGGGGGAGCCAGCCAAAGTGACAAGACACCCGAGGAGCTGTTCCATCCCCTGGGGGCTGATTCC
CAAGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC222696 representing NM_006516
Red=Cloning site Green=Tags(s)

MEPSSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYGESILPTTLTTLWSLSVA
IFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFEMLILGRFIIGVYCGLTTGFV
PMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSIMGNKDLWPLLLSIIFIPALLQCIVLPFCPES
PRFLLINRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL
SQQLSGINAVFYYSTSIFEKAGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAIL
MTIALALLEQLPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPEELFHPLGADS
QV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_006516
ORF Size 1476 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_006516.1, NM_006516.2, NP_006507
RefSeq Size 2856
RefSeq ORF 1479
Locus ID 6513
Cytogenetics 1p34.2
Domains sugar_tr
Protein Families ES Cell Differentiation/IPS, Transmembrane, Druggable Genome
Protein Pathways Adipocytokine signaling pathway, Pathways in cancer, Renal cell carcinoma
MW 53.9 kDa
Gene Summary This gene encodes a major glucose transporter in the mammalian blood-brain barrier. The encoded protein is found primarily in the cell membrane and on the cell surface, where it can also function as a receptor for human T-cell leukemia virus (HTLV) I and II. Mutations in this gene have been found in a family with paroxysmal exertion-induced dyskinesia. [provided by RefSeq, Apr 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (3)