IREB2 (NM_004136) Human Tagged ORF Clone

CAT#: RC221385

Reviews ()
Write a review

IREB2 (Myc-DDK-tagged)-Human iron-responsive element binding protein 2 (IREB2)



  "NM_004136" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 882.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "IREB2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol IREB2
Synonyms ACO3; IRE-BP 2; IRE-BP2; IRP2; IRP2AD; NDCAMA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC221385 representing NM_004136
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACGCCCCAAAAGCAGGATACGCCTTTGAGTACCTTATTGAAACATTAAATGACAGTTCACATAAGA
AGTTCTTCGATGTATCTAAACTTGGCACCAAGTATGATGTTCTGCCTTACTCAATACGGGTCTTGTTGGA
AGCTGCTGTACGAAATTGTGATGGCTTTTTAATGAAGAAGGAAGATGTTATGAACATTTTAGACTGGAAA
ACCAAACAAAGCAATGTTGAAGTGCCCTTTTTCCCTGCCCGTGTTCTTCTTCAAGATTTTACTGGAATAC
CAGCAATGGTGGATTTTGCTGCTATGAGGGAGGCAGTGAAAACTCTTGGAGGTGATCCTGAGAAAGTCCA
TCCTGCTTGTCCGACAGATCTTACAGTTGACCATTCTTTACAAATTGACTTCAGTAAATGTGCAATACAG
AATGCACCAAATCCTGGAGGTGGTGACCTGCAGAAAGCAGGAAAGCTCTCTCCACTTAAAGTGCAGCCTA
AGAAGCTTCCCTGCAGAGGCCAGACTACCTGCCGAGGATCTTGTGATTCTGGAGAACTAGGCCGAAACTC
AGGAACATTTTCTTCGCAGATTGAGAATACACCCATCCTGTGTCCTTTTCATTTGCAACCAGTGCCTGAA
CCTGAAACAGTGTTAAAAAATCAAGAAGTAGAATTCGGCAGAAATCGAGAGAGGCTTCAGTTTTTTAAGT
GGAGTTCAAGAGTTTTTAAGAATGTGGCAGTGATCCCTCCTGGAACTGGAATGGCTCATCAAATAAACTT
AGAATATTTGTCAAGAGTGGTTTTTGAAGAAAAAGACCTCCTCTTCCCAGACAGTGTAGTCGGCACAGAT
TCACACATAACGATGGTGAATGGTTTAGGGATTCTGGGGTGGGGGGTTGGAGGCATTGAAACAGAAGCAG
TTATGCTTGGTCTGCCAGTTTCTCTTACTTTACCAGAGGTGGTTGGATGTGAGTTAACTGGGTCATCAAA
CCCTTTTGTTACATCCATAGATGTTGTTCTTGGTATTACAAAGCACCTCAGGCAAGTAGGAGTGGCTGGA
AAGTTTGTTGAGTTTTTTGGAAGTGGAGTTTCACAATTATCTATAGTTGATCGAACTACAATAGCAAACA
TGTGTCCGGAATATGGTGCTATCCTCAGCTTTTTCCCTGTTGACAATGTGACATTAAAACATTTAGAACA
TACAGGTTTTAGCAAAGCCAAACTCGAATCAATGGAAACATACCTTAAAGCTGTGAAATTGTTTCGAAAT
GACCAGAATTCTTCAGGAGAACCTGAATACTCCCAGGTGATCCAGATTAATCTGAATTCAATAGTTCCAT
CTGTTAGTGGTCCAAAAAGACCTCAGGATAGAGTTGCTGTGACAGATATGAAAAGCGATTTCCAGGCTTG
CTTAAATGAAAAGGTTGGATTTAAAGGCTTCCAAATTGCAGCTGAAAAACAAAAGGATATTGTCTCCATT
CATTATGAAGGAAGTGAATATAAGCTGTCTCATGGATCAGTGGTCATTGCTGCAGTTATCAGTTGTACCA
ATAATTGCAATCCATCTGTCATGCTTGCTGCAGGTCTTTTGGCTAAAAAGGCTGTTGAAGCTGGTCTGCG
TGTTAAACCTTATATAAGAACAAGTTTATCTCCAGGCAGTGGGATGGTTACACATTACCTCAGTTCAAGT
GGAGTATTACCATATCTAAGTAAGCTTGGATTTGAAATCGTTGGCTATGGATGTTCAACTTGTGTGGGAA
ATACAGCACCCTTATCAGACGCAGTTTTAAATGCAGTAAAACAGGGTGATTTGGTTACCTGTGGAATTTT
ATCTGGAAACAAAAATTTTGAAGGTCGTCTTTGTGATTGTGTTCGTGCCAATTATCTTGCCTCTCCACCC
TTAGTGGTAGCTTATGCCATAGCAGGCACAGTGAATATAGATTTCCAGACAGAACCTTTAGGTACTGACC
CCACCGGCAAGAACATTTACCTGCATGATATTTGGCCTAGTCGAGAAGAAGTTCATCGAGTAGAGGAAGA
ACATGTTATACTATCCATGTTTAAAGCATTAAAAGATAAAATAGAAATGGGGAATAAACGGTGGAATTCC
TTAGAAGCACCGGATTCAGTTTTGTTTCCATGGGACTTAAAGTCTACTTATATCAGATGCCCTTCATTTT
TTGATAAACTTACCAAAGAGCCAATTGCACTCCAGGCTATTGAAAATGCCCATGTCTTATTATATTTGGG
AGACTCTGTCACAACAGATCATATATCACCTGCAGGAAGTATCGCTAGGAATAGTGCTGCCGCTAAGTAT
TTGACAAACAGAGGCCTTACCCCTCGTGAATTCAACTCTTACGGAGCTCGAAGAGGTAATGATGCTGTAA
TGACAAGAGGCACTTTTGCAAATATCAAGCTTTTTAATAAGTTTATTGGAAAACCAGCTCCTAAAACAAT
TCATTTTCCATCAGGACAGACGCTAGATGTATTTGAGGCTGCAGAGCTGTACCAGAAAGAAGGTATCCCA
CTGATTATTTTAGCAGGAAAGAAATATGGTTCAGGAAACTCCAGAGACTGGGCTGCCAAAGGACCGTATT
TACTGGGTGTGAAAGCTGTTTTGGCTGAAAGTTATGAAAAAATACACAAAGATCATTTGATTGGAATTGG
CATAGCTCCACTTCAGTTCCTTCCAGGAGAAAATGCAGATTCCTTGGGCCTCTCCGGTAGAGAAACATTT
TCTTTAACATTTCCTGAAGAACTGTCTCCTGGAATTACATTGAATATACAGACAAGCACTGGAAAAGTAT
TCAGCGTGATTGCTTCGTTTGAAGATGATGTGGAAATAACATTATACAAACATGGAGGATTATTAAACTT
TGTGGCACGAAAATTCTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221385 representing NM_004136
Red=Cloning site Green=Tags(s)

MDAPKAGYAFEYLIETLNDSSHKKFFDVSKLGTKYDVLPYSIRVLLEAAVRNCDGFLMKKEDVMNILDWK
TKQSNVEVPFFPARVLLQDFTGIPAMVDFAAMREAVKTLGGDPEKVHPACPTDLTVDHSLQIDFSKCAIQ
NAPNPGGGDLQKAGKLSPLKVQPKKLPCRGQTTCRGSCDSGELGRNSGTFSSQIENTPILCPFHLQPVPE
PETVLKNQEVEFGRNRERLQFFKWSSRVFKNVAVIPPGTGMAHQINLEYLSRVVFEEKDLLFPDSVVGTD
SHITMVNGLGILGWGVGGIETEAVMLGLPVSLTLPEVVGCELTGSSNPFVTSIDVVLGITKHLRQVGVAG
KFVEFFGSGVSQLSIVDRTTIANMCPEYGAILSFFPVDNVTLKHLEHTGFSKAKLESMETYLKAVKLFRN
DQNSSGEPEYSQVIQINLNSIVPSVSGPKRPQDRVAVTDMKSDFQACLNEKVGFKGFQIAAEKQKDIVSI
HYEGSEYKLSHGSVVIAAVISCTNNCNPSVMLAAGLLAKKAVEAGLRVKPYIRTSLSPGSGMVTHYLSSS
GVLPYLSKLGFEIVGYGCSTCVGNTAPLSDAVLNAVKQGDLVTCGILSGNKNFEGRLCDCVRANYLASPP
LVVAYAIAGTVNIDFQTEPLGTDPTGKNIYLHDIWPSREEVHRVEEEHVILSMFKALKDKIEMGNKRWNS
LEAPDSVLFPWDLKSTYIRCPSFFDKLTKEPIALQAIENAHVLLYLGDSVTTDHISPAGSIARNSAAAKY
LTNRGLTPREFNSYGARRGNDAVMTRGTFANIKLFNKFIGKPAPKTIHFPSGQTLDVFEAAELYQKEGIP
LIILAGKKYGSGNSRDWAAKGPYLLGVKAVLAESYEKIHKDHLIGIGIAPLQFLPGENADSLGLSGRETF
SLTFPEELSPGITLNIQTSTGKVFSVIASFEDDVEITLYKHGGLLNFVARKFS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004136
ORF Size 2889 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004136.4
RefSeq Size 3928 bp
RefSeq ORF 2892 bp
Locus ID 3658
UniProt ID P48200
Cytogenetics 15q25.1
Protein Families Druggable Genome
MW 104.9 kDa
Gene Summary The protein encoded by this gene is an RNA-binding protein that acts to regulate iron levels in the cells by regulating the translation and stability of mRNAs that affect iron homeostasis under conditions when iron is depleted. When iron levels are low, this protein binds to iron-responsive elements (IRES), stem-loop structures located either in the 5' or 3' UTRs. Binding to the 5' UTR represses translation, while binding to the 3' UTR inhibits mRNA degradation. When iron is found in the cell, this protein is degraded in a F-box and leucine rich repeat protein 5-dependent manner. Variants in this gene have been associated with lung cancer and chronic obstructive pulmonary disease (COPD). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2017]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.