CXorf40A (NM_178124) Human Tagged ORF Clone

CAT#: RC221372

CXorf40A (Myc-DDK-tagged)-Human chromosome X open reading frame 40A (CXorf40A), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 402.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name CXorf40A (NM_178124) Human Tagged ORF Clone
Symbol CXorf40A
Synonyms CXorf40; EOLA1; FLJ16423
Vector pCMV6-Entry
Sequence Data
>RC221372 representing NM_178124
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGTTTGGCTGCCTCTCCTTCCGGCAGCCTTATGCTGGCTTTGTCTTAAATGGAATCAAGACTGTGG
AGACGCGCTGGCGTCCCCTGCTGAGCAGCCAGCGGAACTGTACCATCGCCGTCCACATTGCTCACAGGGA
CTGGGAAGGCGATGCCTGGCGGGAGCTGCTGGTGGAGAGACTCGGGATGACTCCTGCTCAGATTCAGGCC
TTGCTCAGGAAAGGGGAAAAGTTTGGTCGAGGAGTGATAGCGGGACTCGTTGACATTGGGGAAACTTTGC
AATGCCCCGAAGACTTAACTCCCGATGAGGTTGTGGAACTAGAAAATCAAGCTGTACTGACCAACCTGAA
GCAGAAGTACCTGACTGTGATTTCAAACCCCAGGTGGTTACTGGAGCCCATACCTAGGAAAGGAGGCAAG
GATGTATTCCAGGTAGACATCCCAGAGCACCTGATCCCTTTGGGGCATGAAGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC221372 representing NM_178124
Red=Cloning site Green=Tags(s)

MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDAWRELLVERLGMTPAQIQA
LLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGK
DVFQVDIPEHLIPLGHEV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_178124
ORF Size 474 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_178124.1, NM_178124.2, NM_178124.3, NM_178124.4, NM_178124.5, NP_835225
RefSeq Size 1404
RefSeq ORF 477
Locus ID 91966
Cytogenetics Xq28
MW 17.7 kDa
Gene Summary May have an important role of cell protection in inflammation reaction. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)