HKDC1 (NM_025130) Human Tagged ORF Clone

CAT#: RC221178

HKDC1 (Myc-DDK-tagged)-Human hexokinase domain containing 1 (HKDC1)

Clone Modification / Custom Cloning Service

USD 629.00


Availability*
2 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HKDC1 (NM_025130) Human Tagged ORF Clone
Symbol HKDC1
Synonyms FLJ22761; FLJ37767; MGC125688
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC221178 representing NM_025130
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTGCGGTCCACTTGATGGCATTTTACTTCAGCAAGCTGAAGGAGGACCAGATCAAGAAGGTGGACA
GGTTCCTGTATCACATGCGGCTCTCCGATGACACCCTTTTGGACATCATGAGGCGGTTCCGGGCTGAGAT
GGAGAAGGGCCTGGCAAAGGACACCAACCCCACGGCTGCAGTGAAGATGTTGCCCACCTTCGTCAGGGCC
ATTCCCGATGGTTCCGAAAATGGGGAGTTCCTTTCCCTGGATCTCGGAGGGTCCAAGTTCCGAGTGCTGA
AGGTGCAAGTCGCTGAAGAGGGGAAGCGACACGTGCAGATGGAGAGTCAGTTCTACCCAACGCCCAATGA
AATCATCCGCGGGAACGGCACAGAGCTGTTTGAATATGTAGCTGACTGTCTGGCAGATTTCATGAAGACC
AAAGATTTAAAGCATAAGAAATTGCCCCTTGGCCTAACTTTTTCTTTCCCCTGTCGACAGACTAAACTGG
AAGAGGGTGTCCTACTTTCGTGGACAAAAAAGTTTAAGGCACGAGGAGTTCAGGACACGGATGTGGTGAG
CCGTCTGACCAAAGCCATGAGAAGACACAAGGACATGGACGTGGACATCCTGGCCCTGGTCAATGACACC
GTGGGGACCATGATGACCTGTGCCTATGACGACCCCTACTGCGAAGTTGGTGTCATCATCGGAACTGGCA
CCAATGCGTGTTACATGGAGGACATGAGCAACATTGACCTGGTGGAGGGCGACGAGGGCAGGATGTGCAT
CAACACAGAGTGGGGGGCCTTCGGGGACGACGGGGCCCTGGAGGACATTCGCACTGAGTTCGACAGGGAG
CTGGACCTCGGCTCTCTCAACCCAGGAAAGCAACTGTTCGAGAAGATGATCAGTGGCCTGTACCTGGGGG
AGCTTGTCAGGCTTATCTTGCTGAAGATGGCCAAGGCTGGCCTCCTGTTTGGTGGTGAGAAATCTTCTGC
TCTCCACACTAAGGGCAAGATCGAAACACGGCACGTGGCTGCCATGGAGAAGTATAAAGAAGGCCTTGCT
AATACAAGAGAGATCCTGGTGGACCTGGGTCTGGAACCGTCTGAGGCTGACTGCATTGCCGTCCAGCATG
TCTGTACCATCGTCTCCTTCCGCTCGGCCAATCTCTGTGCAGCAGCTCTGGCGGCCATCCTGACACGCCT
CCGGGAGAACAAGAAGGTGGAACGGCTCCGGACCACAGTGGGCATGGACGGCACCCTCTACAAGATACAC
CCTCAGTACCCAAAACGCCTGCACAAGGTGGTGAGGAAACTGGTCCCAAGCTGTGATGTCCGCTTCCTCC
TGTCAGAGAGTGGCAGCACCAAGGGGGCCGCCATGGTGACCGCGGTGGCCTCCCGCGTGCAGGCCCAGCG
GAAGCAGATCGACAGGGTGCTGGCTTTGTTCCAGCTGACCCGAGAGCAGCTCGTGGACGTGCAGGCCAAG
ATGCGGGCTGAGCTGGAGTATGGGCTGAAGAAGAAGAGCCACGGGCTGGCCACGGTCAGGATGCTGCCCA
CCTACGTCTGCGGGCTGCCGGACGGCACAGAGAAAGGAAAGTTTCTCGCCCTGGATCTTGGGGGAACCAA
CTTCCGGGTCCTCCTGGTGAAGATCAGAAGTGGACGGAGGTCAGTGCGAATGTACAACAAGATCTTCGCC
ATCCCCCTGGAGATCATGCAGGGCACTGGTGAGGAGCTCTTTGATCACATTGTGCAGTGCATCGCCGACT
TCCTGGACTACATGGGCCTCAAGGGAGCCTCCCTACCTTTGGGCTTCACATTCTCATTTCCCTGCAGGCA
GATGAGCATTGACAAGGGAACACTCATAGGGTGGACCAAAGGTTTCAAGGCCACTGACTGTGAAGGGGAG
GACGTGGTGGACATGCTCAGGGAAGCCATCAAGAGGAGAAACGAGTTTGACCTGGACATTGTTGCAGTCG
TGAATGATACAGTGGGGACCATGATGACCTGTGGCTATGAAGATCCTAATTGTGAGATTGGCCTGATTGC
AGGAACAGGCAGCAACATGTGCTACATGGAGGACATGAGGAACATCGAGATGGTGGAGGGGGGTGAAGGG
AAGATGTGCATCAATACAGAGTGGGGAGGATTTGGAGACAATGGCTGCATAGATGACATCCGGACCCGAT
ACGACACGGAGGTGGATGAGGGGTCCTTGAATCCTGGCAAGCAGAGATACGAGAAAATGACCAGTGGGAT
GTACTTGGGGGAGATTGTGCGGCAGATCCTGATCGACCTGACCAAGCAGGGTCTCCTCTTCCGAGGGCAG
ATTTCAGAGCGTCTCCGGACCAGGGGCATCTTCGAAACCAAGTTCCTGTCCCAGATCGAAAGCGATCGGC
TGGCCCTTCTCCAGGTCAGGAGGATTCTGCAGCAGCTGGGCCTGGACAGCACGTGTGAGGACAGCATCGT
GGTGAAGGAGGTGTGCGGAGCCGTGTCCCGGCGGGCGGCCCAGCTCTGCGGTGCTGGCCTGGCCGCTATA
GTGGAAAAAAGGAGAGAAGACCAGGGGCTAGAGCACCTGAGGATCACTGTGGGTGTGGACGGCACCCTGT
ACAAGCTGCACCCTCACTTTTCTAGAATATTGCAGGAAACTGTGAAGGAACTAGCCCCTCGATGTGATGT
GACATTCATGCTGTCAGAAGATGGCAGTGGAAAAGGGGCAGCACTGATCACTGCTGTGGCCAAGAGGTTA
CAGCAGGCACAGAAGGAGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC221178 representing NM_025130
Red=Cloning site Green=Tags(s)

MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMRRFRAEMEKGLAKDTNPTAAVKMLPTFVRA
IPDGSENGEFLSLDLGGSKFRVLKVQVAEEGKRHVQMESQFYPTPNEIIRGNGTELFEYVADCLADFMKT
KDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGVQDTDVVSRLTKAMRRHKDMDVDILALVNDT
VGTMMTCAYDDPYCEVGVIIGTGTNACYMEDMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRE
LDLGSLNPGKQLFEKMISGLYLGELVRLILLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLA
NTREILVDLGLEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKVERLRTTVGMDGTLYKIH
PQYPKRLHKVVRKLVPSCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDRVLALFQLTREQLVDVQAK
MRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEKGKFLALDLGGTNFRVLLVKIRSGRRSVRMYNKIFA
IPLEIMQGTGEELFDHIVQCIADFLDYMGLKGASLPLGFTFSFPCRQMSIDKGTLIGWTKGFKATDCEGE
DVVDMLREAIKRRNEFDLDIVAVVNDTVGTMMTCGYEDPNCEIGLIAGTGSNMCYMEDMRNIEMVEGGEG
KMCINTEWGGFGDNGCIDDIRTRYDTEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQ
ISERLRTRGIFETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAI
VEKRREDQGLEHLRITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTFMLSEDGSGKGAALITAVAKRL
QQAQKEN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_025130
ORF Size 2751 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_025130.2, NM_025130.3, NP_079406
RefSeq Size 3689
RefSeq ORF 2754
Locus ID 80201
Cytogenetics 10q22.1
Domains hexokinase
Protein Families Druggable Genome
MW 102.3 kDa
Gene Summary This gene encodes a member of the hexokinase protein family. The encoded protein is involved in glucose metabolism, and reduced expression may be associated with gestational diabetes mellitus. High expression of this gene may also be associated with poor prognosis in hepatocarcinoma. [provided by RefSeq, Sep 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)