LATS2 (NM_014572) Human Tagged ORF Clone

CAT#: RC219394

Reviews ()
Write a review

LATS2 (Myc-DDK-tagged)-Human LATS, large tumor suppressor, homolog 2 (Drosophila) (LATS2)



  "NM_014572" in other vectors (7)

Reconstitution Protocol

USD 947.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "LATS2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol LATS2
Synonyms KPM
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC219394 representing NM_014572
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGCCAAAGACTTTTCCTGCCACGACTTATTCTGGAAATAGCCGGCAGCGACTGCAAGAGATTCGTG
AGGGGTTAAAGCAGCCATCCAAGTCTTCGGTTCAGGGGCTACCCGCAGGACCAAACAGTGACACTTCCCT
GGATGCCAAAGTCCTGGGGAGCAAAGATGCCACCAGGCAGCAGCAGCAGATGAGAGCCACCCCAAAGTTC
GGACCTTATCAGAAAGCCTTGAGGGAAATCAGATATTCCTTGTTGCCTTTTGCTAATGAATCGGGCACCT
CTGCAGCTGCAGAAGTGAACCGGCAAATGCTGCAGGAACTGGTGAACGCAGGATGCGACCAGGAGATGGC
TGGCCGAGCTCTCAAGCAGACTGGCAGCAGGAGCATCGAGGCCGCCCTGGAGTACATCAGCAAGATGGGC
TACCTGGACCCGAGGAATGAGCAGATTGTGCGGGTCATTAAGCAGACCTCCCCAGGAAAGGGGCTCATGC
CAACCCCAGTGACGCGGAGGCCCAGCTTCGAAGGAACCGGCGATTCGTTTGCGTCCTACCACCAGCTGAG
CGGTACCCCCTACGAGGGCCCAAGCTTCGGCGCTGACGGCCCCACGGCGCTGGAGGAGATGCCGCGGCCG
TACGTGGACTACCTTTTCCCCGGAGTCGGCCCCCACGGGCCCGGCCACCAGCACCAGCACCCACCCAAGG
GCTACGGTGCCAGCGTAGAGGCAGCAGGGGCACACTTCCCGCTGCAGGGCGCGCACTACGGGCGGCCGCA
CCTGCTGGTGCCTGGGGAACCCCTGGGCTACGGAGTGCAGCGCAGCCCCTCCTTCCAGAGCAAGACGCCG
CCGGAGACCGGGGGTTACGCCAGCCTGCCCACGAAGGGCCAGGGAGGACCGCCAGGCGCCGGCCTCGCTT
TCCCACCCCCTGCCGCCGGGCTCTACGTGCCGCACCCACACCACAAGCAGGCCGGTCCCGCGGCCCACCA
GCTGCATGTGCTGGGCTCCCGCAGCCAGGTGTTCGCCAGCGACAGCCCCCCGCAGAGCCTGCTCACTCCC
TCGCGGAACAGCCTCAACGTGGACCTGTATGAATTGGGCAGCACCTCCGTCCAGCAGTGGCCGGCTGCCA
CCCTGGCCCGCCGGGACTCCCTGCAGAAGCCGGGCCTGGAGGCGCCGCCGCGCGCGCACGTGGCCTTCCG
GCCTGACTGCCCAGTGCCCAGCAGGACCAACTCCTTCAACAGCCACCAGCCGCGGCCCGGTCCGCCTGGC
AAGGCCGAGCCCTCCCTGCCCGCCCCCAACACCGTGACGGCTGTCACGGCCGCGCACATCTTGCACCCGG
TGAAGAGCGTGCGTGTGCTGAGGCCGGAGCCGCAGACGGCTGTGGGGCCCTCGCACCCCGCCTGGGTGCC
CGCGCCTGCCCCGGCCCCCGCCCCCGCCCCCGCCCCGGCTGCGGAGGGCTTGGACGCCAAGGAGGAGCAT
GCCCTGGCGCTGGGCGGCGCAGGCGCCTTCCCGCTGGACGTGGAGTACGGAGGCCCAGACCGGAGGTGCC
CGCCTCCGCCCTACCCGAAGCACCTGCTGCTGCGCAGCAAGTCGGAGCAGTACGACCTGGACAGCCTGTG
CGCAGGCATGGAGCAGAGCCTCCGTGCGGGCCCCAACGAGCCCGAGGGCGGCGACAAGAGCCGCAAAAGC
GCCAAGGGGGACAAAGGCGGAAAGGATAAAAAGCAGATTCAGACCTCTCCCGTTCCCGTCCGCAAAAACA
GCAGAGACGAAGAGAAGAGAGAGTCACGCATCAAGAGCTACTCGCCATACGCCTTTAAGTTCTTCATGGA
GCAGCACGTGGAGAATGTCATCAAAACCTACCAGCAGAAGGTTAACCGGAGGCTGCAGCTGGAGCAAGAA
ATGGCCAAAGCTGGACTCTGTGAAGCTGAGCAGGAGCAGATGCGGAAGATCCTCTACCAGAAAGAGTCTA
ATTACAACAGGTTAAAGAGGGCCAAGATGGACAAGTCTATGTTTGTCAAGATCAAAACCCTGGGGATCGG
TGCCTTTGGAGAAGTGTGCCTTGCTTGTAAGGTGGACACTCACGCCCTGTACGCCATGAAGACCCTAAGG
AAAAAGGATGTCCTGAACCGGAATCAGGTGGCCCACGTCAAGGCCGAGAGGGACATCCTGGCCGAGGCAG
ACAATGAGTGGGTGGTCAAACTCTACTACTCCTTCCAAGACAAAGACAGCCTGTACTTTGTGATGGACTA
CATCCCTGGTGGGGACATGATGAGCCTGCTGATCCGGATGGAGGTCTTCCTTGAGCACCTGGCCCGGTTC
TACATCGCAGAGCTGACTTTGGCCATTGAGAGTGTCCACAAGATGGGCTTCATCCACCGAGACATCAAGC
CTGATAACATTTTGATAGATCTGGATGGTCACATTAAACTCACAGATTTCGGCCTCTGCACTGGGTTCAG
GTGGACTCACAATTCCAAATATTACCAGAAAGGGAGCCATGTCAGACAGGACAGCATGGAGCCCAGCGAC
CTCTGGGATGATGTGTCTAACTGTCGGTGTGGGGACAGGCTGAAGACCCTAGAGCAGAGGGCGCGGAAGC
AGCACCAGAGGTGCCTGGCACATTCACTGGTGGGGACTCCAAACTACATCGCACCCGAGGTGCTCCTCCG
CAAAGGGTACACTCAACTCTGTGACTGGTGGAGTGTTGGAGTGATTCTCTTCGAGATGCTGGTGGGGCAG
CCGCCCTTTTTGGCACCTACTCCCACAGAAACCCAGCTGAAGGTGATCAACTGGGAGAACACGCTCCACA
TTCCAGCCCAGGTGAAGCTGAGCCCTGAGGCCAGGGACCTCATCACCAAGCTGTGCTGCTCCGCAGACCA
CCGCCTGGGGCGGAATGGGGCCGATGACCTGAAGGCCCACCCCTTCTTCAGCGCCATTGACTTCTCCAGT
GACATCCGGAAGCAGCCAGCCCCCTACGTTCCCACCATCAGCCACCCCATGGACACCTCGAATTTCGACC
CCGTAGATGAAGAAAGCCCTTGGAACGATGCCAGCGAAGGTAGCACCAAGGCCTGGGACACACTCACCTC
GCCCAATAACAAGCATCCTGAGCACGCATTTTACGAATTCACCTTCCGAAGGTTCTTTGATGACAATGGC
TACCCCTTTCGATGCCCAAAGCCTTCAGGAGCAGAAGCTTCACAGGCTGAGAGCTCAGATTTAGAAAGCT
CTGATCTGGTGGATCAGACTGAAGGCTGCCAGCCTGTGTACGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC219394 representing NM_014572
Red=Cloning site Green=Tags(s)

MRPKTFPATTYSGNSRQRLQEIREGLKQPSKSSVQGLPAGPNSDTSLDAKVLGSKDATRQQQQMRATPKF
GPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRALKQTGSRSIEAALEYISKMG
YLDPRNEQIVRVIKQTSPGKGLMPTPVTRRPSFEGTGDSFASYHQLSGTPYEGPSFGADGPTALEEMPRP
YVDYLFPGVGPHGPGHQHQHPPKGYGASVEAAGAHFPLQGAHYGRPHLLVPGEPLGYGVQRSPSFQSKTP
PETGGYASLPTKGQGGPPGAGLAFPPPAAGLYVPHPHHKQAGPAAHQLHVLGSRSQVFASDSPPQSLLTP
SRNSLNVDLYELGSTSVQQWPAATLARRDSLQKPGLEAPPRAHVAFRPDCPVPSRTNSFNSHQPRPGPPG
KAEPSLPAPNTVTAVTAAHILHPVKSVRVLRPEPQTAVGPSHPAWVPAPAPAPAPAPAPAAEGLDAKEEH
ALALGGAGAFPLDVEYGGPDRRCPPPPYPKHLLLRSKSEQYDLDSLCAGMEQSLRAGPNEPEGGDKSRKS
AKGDKGGKDKKQIQTSPVPVRKNSRDEEKRESRIKSYSPYAFKFFMEQHVENVIKTYQQKVNRRLQLEQE
MAKAGLCEAEQEQMRKILYQKESNYNRLKRAKMDKSMFVKIKTLGIGAFGEVCLACKVDTHALYAMKTLR
KKDVLNRNQVAHVKAERDILAEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFLEHLARF
YIAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGSHVRQDSMEPSD
LWDDVSNCRCGDRLKTLEQRARKQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVGVILFEMLVGQ
PPFLAPTPTETQLKVINWENTLHIPAQVKLSPEARDLITKLCCSADHRLGRNGADDLKAHPFFSAIDFSS
DIRKQPAPYVPTISHPMDTSNFDPVDEESPWNDASEGSTKAWDTLTSPNNKHPEHAFYEFTFRRFFDDNG
YPFRCPKPSGAEASQAESSDLESSDLVDQTEGCQPVYV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014572
ORF Size 3264 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014572.3
RefSeq Size 4098 bp
RefSeq ORF 3267 bp
Locus ID 26524
UniProt ID Q9NRM7
Cytogenetics 13q12.11
Domains UBA, pkinase, S_TK_X, TyrKc, S_TKc
Protein Families Druggable Genome, Protein Kinase
MW 120 kDa
Gene Summary This gene encodes a serine/threonine protein kinase belonging to the LATS tumor suppressor family. The protein localizes to centrosomes during interphase, and early and late metaphase. It interacts with the centrosomal proteins aurora-A and ajuba and is required for accumulation of gamma-tubulin and spindle formation at the onset of mitosis. It also interacts with a negative regulator of p53 and may function in a positive feedback loop with p53 that responds to cytoskeleton damage. Additionally, it can function as a co-repressor of androgen-responsive gene expression. [provided by RefSeq, Jul 2008]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.