Myoferlin (MYOF) (NM_013451) Human Tagged ORF Clone

CAT#: RC218766

Reviews ()
Write a review

MYOF (Myc-DDK-tagged)-Human myoferlin (MYOF), transcript variant 1



Reconstitution Protocol

USD 1,701.00

In Stock*

Size
    • 10 ug

Product images

Other products for "MYOF"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MYOF
Synonyms FER1L3; HAE7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC218766 representing NM_013451
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCGAGTGATTGTGGAATCTGCCAGCAATATCCCTAAAACGAAATTTGGCAAGCCGGATCCTATTG
TTTCTGTCATTTTTAAGGATGAGAAAAAGAAAACAAAGAAAGTTGATAATGAATTGAACCCTGTCTGGAA
TGAGATTTTGGAGTTTGACTTGAGGGGTATACCACTGGACTTTTCATCTTCCCTTGGGATTATTGTGAAA
GATTTTGAGACAATTGGACAAAATAAATTAATTGGCACGGCGACTGTAGCCCTGAAGGACCTGACTGGTG
ACCAGAGCAGATCCCTGCCGTACAAGCTGATCTCCCTGCTAAATGAAAAAGGGCAAGATACTGGGGCCAC
CATTGACTTGGTGATCGGCTATGATCCGCCTTCTGCTCCACATCCAAATGACCTGAGCGGGCCCAGCGTG
CCAGGCATGGGAGGAGATGGGGAAGAAGATGAAGGTGATGAAGACAGGTTGGACAATGCAGTCAGGGGCC
CTGGGCCCAAGGGGCCAGTTGGGACGGTGTCGGAAGCTCAGCTTGCTCGGAGGCTCACCAAAGTAAAGAA
CAGCCGGCGGATGCTGTCAAATAAGCCACAGGACTTCCAGATCCGCGTCCGAGTGATTGAGGGCCGACAG
TTAAGTGGTAACAACATAAGGCCTGTGGTCAAAGTTCACGTCTGTGGCCAGACACACCGAACAAGAATCA
AGAGAGGAAACAACCCTTTTTTTGATGAGTTGTTTTTCTACAATGTCAACATGACCCCTTCTGAATTGAT
GGATGAGATCATCAGCATCCGGGTTTATAATTCTCACTCTCTGCGGGCAGATTGTCTGATGGGGGAATTT
AAGATTGATGTTGGATTTGTTTATGATGAACCTGGCCATGCTGTCATGAGAAAGTGGCTTCTTCTCAATG
ACCCGGAAGATACCAGTTCAGGTTCTAAAGGTTATATGAAAGTCAGCATGTTTGTCCTGGGAACCGGAGA
TGAGCCTCCTCCTGAGAGACGAGATCGTGATAATGACAGTGATGATGTGGAGAGTAATTTGTTACTCCCT
GCTGGCATTGCCCTCCGGTGGGTGACCTTCTTGCTGAAAATCTACCGAGCTGAGGACATCCCCCAGATGG
ATGATGCCTTCTCACAGACAGTAAAGGAAATATTTGGAGGCAATGCAGATAAGAAAAATCTCGTGGATCC
TTTTGTAGAAGTTTCCTTTGCTGGAAAAAAGGTTTGTACAAACATAATTGAGAAAAATGCAAACCCAGAG
TGGAATCAGGTCGTCAATCTTCAGATCAAGTTTCCTTCAGTGTGTGAAAAAATAAAACTAACAATATATG
ACTGGGACCGTCTTACTAAAAATGATGTAGTTGGAACAACATATCTACACCTCTCTAAAATTGCTGCCTC
TGGTGGGGAAGTGGAAGATTTCTCATCTTCGGGAACTGGGGCTGCATCATATACAGTAAACACAGGAGAA
ACAGAGGTAGGCTTTGTTCCAACGTTTGGACCTTGTTACCTGAATCTTTATGGAAGCCCCAGAGAGTACA
CGGGATTCCCAGACCCCTATGATGAGCTGAATACTGGAAAGGGGGAAGGAGTTGCCTACAGAGGCAGGAT
CTTGGTTGAATTAGCCACTTTTCTTGAGAAGACACCACCAGATAAAAAGCTTGAGCCCATTTCAAATGAT
GACCTGCTGGTTGTTGAGAAATACCAGCGAAGGCGGAAGTACAGCCTGTCTGCCGTGTTTCATTCAGCCA
CCATGTTGCAAGATGTTGGTGAGGCCATTCAGTTTGAAGTCAGCATTGGGAACTATGGCAACAAGTTTGA
CACCACCTGTAAGCCTTTGGCATCAACAACTCAGTACAGCCGTGCTGTATTTGATGGCAACTACTATTAT
TACTTGCCTTGGGCCCACACCAAGCCAGTTGTTACCCTGACTTCATACTGGGAGGATATTAGTCATCGCC
TGGATGCGGTGAACACTCTCCTAGCTATGGCAGAACGGCTGCAAACAAATATAGAAGCTCTAAAATCAGG
GATACAAGGTAAAATTCCTGCAAACCAGCTGGCTGAATTGTGGCTGAAGCTGATAGATGAAGTTATAGAA
GACACGAGATACACGTTGCCTCTCACAGAAGGAAAAGCCAACGTCACAGTTCTCGATACTCAGATCCGAA
AGCTGCGGTCCAGGTCTCTCTCCCAAATACATGAGGCGGCTGTGAGGATGAGGTCGGAAGCCACAGATGT
GAAGTCCACACTGGCAGAAATTGAGGACTGGCTTGATAAATTAATGCAGCTGACTGAAGAGCCACAGAAC
AGCATGCCTGACATCATCATCTGGATGATCCGGGGAGAGAAGAGACTGGCCTATGCACGAATTCCCGCAC
ATCAGGTCTTGTACTCCACCAGTGGTGAGAATGCATCTGGAAAATACTGTGGGAAAACCCAAACCATCTT
TCTGAAGTATCCACAGGAGAAAAACAACGGGCCAAAGGTGCCTGTGGAGTTGCGAGTGAACATCTGGCTA
GGCTTAAGTGCTGTGGAGAAGAAGTTTAACAGCTTCGCAGAAGGAACTTTCACCGTCTTTGCTGAAATGT
ATGAAAATCAAGCTCTCATGTTTGGAAAATGGGGTACTTCTGGATTAGTAGGACGTCATAAGTTTTCTGA
TGTCACAGGAAAAATAAAACTCAAGAGGGAATTTTTTCTGCCTCCAAAAGGCTGGGAATGGGAAGGAGAG
TGGATAGTTGATCCTGAAAGAAGCTTGCTGACTGAGGCAGATGCAGGTCACACGGAGTTCACTGATGAAG
TCTATCAGAACGAGAGCCGCTACCCCGGGGGCGACTGGAAGCCGGCCGAGGACACCTACACGGATGCGAA
CGGCGATAAAGCAGCATCACCCAGCGAGTTGACTTGTCCTCCAGGTTGGGAATGGGAAGATGATGCATGG
TCTTATGACATAAATCGAGCGGTGGATGAGAAAGGCTGGGAATATGGAATCACCATTCCTCCTGATCATA
AGCCCAAATCCTGGGTTGCAGCAGAGAAAATGTACCACACTCATAGACGGCGAAGGCTGGTCCGAAAACG
CAAGAAAGATTTAACACAGACTGCTTCAAGCACCGCAAGGGCCATGGAGGAATTGCAAGACCAAGAGGGC
TGGGAATATGCTTCTCTAATTGGCTGGAAATTTCACTGGAAACAACGTAGTTCAGATACCTTCCGCCGCA
GACGCTGGAGGAGAAAAATGGCTCCTTCAGAAACACATGGTGCAGCTGCCATCTTTAAACTTGAAGGTGC
CCTTGGGGCAGACACTACCGAAGATGGGGATGAGAAGAGCCTGGAGAAACAGAAGCACAGTGCCACCACT
GTGTTCGGAGCAAACACCCCCATTGTTTCCTGCAATTTTGACAGAGTCTACATCTACCATCTGCGCTGCT
ATGTCTATCAAGCCAGAAACCTCTTGGCTTTAGATAAGGATAGCTTTTCAGATCCATATGCTCATATCTG
TTTCCTCCATCGGAGCAAAACCACTGAGATCATCCATTCAACCCTGAATCCCACGTGGGACCAAACAATT
ATATTCGATGAAGTTGAAATCTATGGGGAACCCCAAACAGTTCTACAGAATCCACCCAAAGTTATCATGG
AACTTTTTGACAATGACCAAGTGGGCAAAGATGAATTTTTAGGACGAAGCATTTTCTCTCCTGTGGTGAA
ACTGAACTCAGAAATGGACATCACACCCAAACTTCTCTGGCACCCAGTAATGAATGGAGACAAAGCCTGC
GGGGATGTTCTTGTAACTGCAGAGCTGATTCTGAGGGGCAAGGATGGCTCCAACCTTCCCATTCTTCCCC
CTCAAAGGGCGCCAAATCTATACATGGTCCCCCAGGGGATCAGGCCTGTGGTCCAGCTCACTGCCATTGA
GATTCTAGCTTGGGGCTTAAGAAATATGAAAAACTTCCAGATGGCTTCTATCACATCCCCCAGTCTTGTT
GTGGAGTGTGGAGGAGAAAGGGTGGAATCGGTGGTGATCAAAAACCTTAAGAAGACACCCAACTTTCCAA
GTTCTGTTCTCTTCATGAAAGTGTTCTTGCCCAAGGAGGAATTGTACATGCCCCCACTGGTGATCAAGGT
CATCGACCACAGGCAGTTTGGGCGGAAGCCTGTCGTCGGCCAGTGCACCATCGAGCGCCTGGACCGCTTT
CGCTGTGACCCTTATGCAGGGAAAGAGGACATCGTCCCACAGCTCAAAGCCTCCCTTCTGTCTGCCCCAC
CATGCCGGGACATCGTTATCGAAATGGAAGACACCAAACCATTACTGGCTTCTAAGCTGACAGAAAAGGA
GGAAGAAATCGTGGACTGGTGGAGTAAATTTTATGCTTCCTCAGGGGAACATGAAAAATGCGGACAGTAT
ATTCAGAAAGGCTATTCCAAGCTCAAGATATATAATTGTGAACTAGAAAATGTAGCAGAATTTGAGGGCC
TGACAGACTTCTCAGATACGTTCAAGTTGTACCGAGGCAAGTCGGATGAAAATGAAGATCCTTCTGTGGT
TGGAGAGTTTAAGGGCTCCTTTCGGATCTACCCTCTGCCGGATGACCCCAGCGTGCCAGCCCCTCCCAGA
CAGTTTCGGGAATTACCTGACAGCGTCCCACAGGAATGCACGGTTAGGATTTACATTGTTCGAGGCTTAG
AGCTCCAGCCCCAGGACAACAATGGCCTGTGTGACCCTTACATAAAAATAACACTGGGCAAAAAAGTCAT
TGAAGACCGAGATCACTACATTCCCAACACTCTCAACCCAGTCTTTGGCAGGATGTACGAACTGAGCTGC
TACTTACCTCAAGAAAAAGACCTGAAAATTTCTGTCTATGATTATGACACCTTTACCCGGGATGAAAAAG
TAGGAGAAACAATTATTGATCTGGAAAACCGATTCCTTTCCCGCTTTGGGTCCCACTGCGGCATACCAGA
GGAGTACTGTGTTTCTGGAGTCAATACCTGGCGAGATCAACTGAGACCAACACAGCTGCTTCAAAATGTC
GCCAGATTCAAAGGCTTCCCACAACCCATCCTTTCCGAAGATGGGAGTAGAATCAGATATGGAGGACGAG
ACTACAGCTTGGATGAATTTGAAGCCAACAAAATCCTGCACCAGCACCTCGGGGCCCCTGAAGAGCGGCT
TGCTCTTCACATCCTCAGGACTCAGGGGCTGGTCCCTGAGCACGTGGAAACAAGGACTTTGCACAGCACC
TTCCAGCCCAACATTTCCCAGGGAAAACTTCAGATGTGGGTGGATGTTTTCCCCAAGAGTTTGGGGCCAC
CAGGCCCTCCTTTCAACATCACACCCCGGAAAGCCAAGAAATACTACCTGCGTGTGATCATCTGGAACAC
CAAGGACGTTATCTTGGACGAGAAAAGCATCACAGGAGAGGAAATGAGTGACATCTACGTCAAAGGCTGG
ATTCCTGGCAATGAAGAAAACAAACAGAAAACAGATGTCCATTACAGATCTTTGGATGGTGAAGGGAATT
TTAACTGGCGATTTGTTTTCCCGTTTGACTACCTTCCAGCCGAACAACTCTGTATCGTTGCGAAAAAAGA
GCATTTCTGGAGTATTGACCAAACGGAATTTCGAATCCCACCCAGGCTGATCATTCAGATATGGGACAAT
GACAAGTTTTCTCTGGATGACTACTTGGGTTTCCTAGAACTTGACTTGCGTCACACGATCATTCCTGCAA
AATCACCAGAGAAATGCAGATTGGACATGATTCCGGACCTCAAAGCCATGAACCCCCTTAAAGCCAAGAC
AGCCTCCCTCTTTGAGCAGAAGTCCATGAAAGGATGGTGGCCATGCTACGCAGAGAAAGATGGCGCCCGC
GTAATGGCTGGGAAAGTGGAGATGACATTGGAAATCCTCAACGAGAAGGAGGCCGACGAGAGGCCAGCCG
GGAAGGGGCGGGACGAACCCAACATGAACCCCAAGCTGGACTTACCAAATCGACCAGAAACCTCCTTCCT
CTGGTTCACCAACCCATGCAAGACCATGAAGTTCATCGTGTGGCGCCGCTTTAAGTGGGTCATCATCGGC
TTGCTGTTCCTGCTTATCCTGCTGCTCTTCGTGGCCGTGCTCCTCTACTCTTTGCCGAACTATTTGTCAA
TGAAGATTGTAAAGCCAAATGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC218766 representing NM_013451
Red=Cloning site Green=Tags(s)

MLRVIVESASNIPKTKFGKPDPIVSVIFKDEKKKTKKVDNELNPVWNEILEFDLRGIPLDFSSSLGIIVK
DFETIGQNKLIGTATVALKDLTGDQSRSLPYKLISLLNEKGQDTGATIDLVIGYDPPSAPHPNDLSGPSV
PGMGGDGEEDEGDEDRLDNAVRGPGPKGPVGTVSEAQLARRLTKVKNSRRMLSNKPQDFQIRVRVIEGRQ
LSGNNIRPVVKVHVCGQTHRTRIKRGNNPFFDELFFYNVNMTPSELMDEIISIRVYNSHSLRADCLMGEF
KIDVGFVYDEPGHAVMRKWLLLNDPEDTSSGSKGYMKVSMFVLGTGDEPPPERRDRDNDSDDVESNLLLP
AGIALRWVTFLLKIYRAEDIPQMDDAFSQTVKEIFGGNADKKNLVDPFVEVSFAGKKVCTNIIEKNANPE
WNQVVNLQIKFPSVCEKIKLTIYDWDRLTKNDVVGTTYLHLSKIAASGGEVEDFSSSGTGAASYTVNTGE
TEVGFVPTFGPCYLNLYGSPREYTGFPDPYDELNTGKGEGVAYRGRILVELATFLEKTPPDKKLEPISND
DLLVVEKYQRRRKYSLSAVFHSATMLQDVGEAIQFEVSIGNYGNKFDTTCKPLASTTQYSRAVFDGNYYY
YLPWAHTKPVVTLTSYWEDISHRLDAVNTLLAMAERLQTNIEALKSGIQGKIPANQLAELWLKLIDEVIE
DTRYTLPLTEGKANVTVLDTQIRKLRSRSLSQIHEAAVRMRSEATDVKSTLAEIEDWLDKLMQLTEEPQN
SMPDIIIWMIRGEKRLAYARIPAHQVLYSTSGENASGKYCGKTQTIFLKYPQEKNNGPKVPVELRVNIWL
GLSAVEKKFNSFAEGTFTVFAEMYENQALMFGKWGTSGLVGRHKFSDVTGKIKLKREFFLPPKGWEWEGE
WIVDPERSLLTEADAGHTEFTDEVYQNESRYPGGDWKPAEDTYTDANGDKAASPSELTCPPGWEWEDDAW
SYDINRAVDEKGWEYGITIPPDHKPKSWVAAEKMYHTHRRRRLVRKRKKDLTQTASSTARAMEELQDQEG
WEYASLIGWKFHWKQRSSDTFRRRRWRRKMAPSETHGAAAIFKLEGALGADTTEDGDEKSLEKQKHSATT
VFGANTPIVSCNFDRVYIYHLRCYVYQARNLLALDKDSFSDPYAHICFLHRSKTTEIIHSTLNPTWDQTI
IFDEVEIYGEPQTVLQNPPKVIMELFDNDQVGKDEFLGRSIFSPVVKLNSEMDITPKLLWHPVMNGDKAC
GDVLVTAELILRGKDGSNLPILPPQRAPNLYMVPQGIRPVVQLTAIEILAWGLRNMKNFQMASITSPSLV
VECGGERVESVVIKNLKKTPNFPSSVLFMKVFLPKEELYMPPLVIKVIDHRQFGRKPVVGQCTIERLDRF
RCDPYAGKEDIVPQLKASLLSAPPCRDIVIEMEDTKPLLASKLTEKEEEIVDWWSKFYASSGEHEKCGQY
IQKGYSKLKIYNCELENVAEFEGLTDFSDTFKLYRGKSDENEDPSVVGEFKGSFRIYPLPDDPSVPAPPR
QFRELPDSVPQECTVRIYIVRGLELQPQDNNGLCDPYIKITLGKKVIEDRDHYIPNTLNPVFGRMYELSC
YLPQEKDLKISVYDYDTFTRDEKVGETIIDLENRFLSRFGSHCGIPEEYCVSGVNTWRDQLRPTQLLQNV
ARFKGFPQPILSEDGSRIRYGGRDYSLDEFEANKILHQHLGAPEERLALHILRTQGLVPEHVETRTLHST
FQPNISQGKLQMWVDVFPKSLGPPGPPFNITPRKAKKYYLRVIIWNTKDVILDEKSITGEEMSDIYVKGW
IPGNEENKQKTDVHYRSLDGEGNFNWRFVFPFDYLPAEQLCIVAKKEHFWSIDQTEFRIPPRLIIQIWDN
DKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDMIPDLKAMNPLKAKTASLFEQKSMKGWWPCYAEKDGAR
VMAGKVEMTLEILNEKEADERPAGKGRDEPNMNPKLDLPNRPETSFLWFTNPCKTMKFIVWRRFKWVIIG
LLFLLILLLFVAVLLYSLPNYLSMKIVKPNV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_013451
ORF Size 6183 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_013451.4
RefSeq Size 6829 bp
RefSeq ORF 6186 bp
Locus ID 26509
UniProt ID Q9NZM1
Cytogenetics 10q23.33
Domains C2, DysFN, DysFC
Protein Families Transmembrane
MW 234.5 kDa
Gene Summary Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. The protein encoded by this gene is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found for this gene. Other possible variants have been detected, but their full-length nature has not been determined. [provided by RefSeq, Dec 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.