Frizzled 4(FZD4) (NM_012193) Human Tagged ORF Clone

CAT#: RC217286

FZD4 (Myc-DDK-tagged)-Human frizzled family receptor 4 (FZD4)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Frizzled 4(FZD4) (NM_012193) Human Tagged ORF Clone
Symbol FZD4
Synonyms CD344; EVR1; FEVR; Fz-4; Fz4; FZD4S; FzE4; GPCR; hFz4
Vector pCMV6-Entry
Sequence Data
>RC217286 representing NM_012193
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTGGCGGGGCGCAGGGCCGAGCGTCCCGGGGGCGCCCGGGGGCGTCGGTCTCAGTCTGGGGTTGC
TCCTGCAGTTGCTGCTGCTCCTGGGGCCGGCGCGGGGCTTCGGGGACGAGGAAGAGCGGCGCTGCGACCC
CATCCGCATCTCCATGTGCCAGAACCTCGGCTACAACGTGACCAAGATGCCCAACCTGGTTGGGCACGAG
CTGCAGACGGACGCCGAGCTGCAGCTGACAACTTTCACACCGCTCATCCAGTACGGCTGCTCCAGCCAGC
TGCAGTTCTTCCTTTGTTCTGTTTATGTGCCAATGTGCACAGAGAAGATCAACATCCCCATTGGCCCATG
CGGCGGCATGTGTCTTTCAGTCAAGAGACGCTGTGAACCCGTCCTGAAGGAATTTGGATTTGCCTGGCCA
GAGAGTCTGAACTGCAGCAAATTCCCACCACAGAACGACCACAACCACATGTGCATGGAAGGGCCAGGTG
ATGAAGAGGTGCCCTTACCTCACAAAACCCCCATCCAGCCTGGGGAAGAGTGTCACTCTGTGGGAACCAA
TTCTGATCAGTACATCTGGGTGAAAAGGAGCCTGAACTGTGTGCTCAAGTGTGGCTATGATGCTGGCTTA
TACAGCCGCTCAGCCAAGGAGTTCACTGATATCTGGATGGCTGTGTGGGCCAGCCTGTGTTTCATCTCCA
CTGCCTTCACAGTACTGACCTTCCTGATCGATTCTTCTAGGTTTTCCTACCCTGAGCGCCCCATCATATT
TCTCAGTATGTGCTATAATATTTATAGCATTGCTTATATTGTCAGGCTGACTGTAGGCCGGGAAAGGATA
TCCTGTGATTTTGAAGAGGCAGCAGAACCTGTTCTCATCCAAGAAGGACTTAAGAACACAGGATGTGCAA
TAATTTTCTTGCTGATGTACTTTTTTGGAATGGCCAGCTCCATTTGGTGGGTTATTCTGACACTCACTTG
GTTTTTGGCAGCAGGACTCAAATGGGGTCATGAAGCCATTGAAATGCACAGCTCTTATTTCCACATTGCA
GCCTGGGCCATCCCCGCAGTGAAAACCATTGTCATCTTGATTATGAGACTGGTGGATGCAGATGAACTGA
CTGGCTTGTGCTATGTTGGAAACCAAAATCTCGATGCCCTCACCGGGTTCGTGGTGGCTCCCCTCTTTAC
TTATTTGGTCATTGGAACTTTGTTCATTGCTGCAGGTTTGGTGGCCTTGTTCAAAATTCGGTCAAATCTT
CAAAAGGATGGGACAAAGACAGACAAGTTAGAAAGACTGATGGTCAAGATTGGGGTGTTCTCAGTACTGT
ACACAGTTCCTGCAACGTGTGTGATTGCCTGTTATTTTTATGAAATCTCCAACTGGGCACTTTTTCGGTA
TTCTGCAGATGATTCCAACATGGCTGTTGAAATGTTGAAAATTTTTATGTCTTTGTTGGTGGGCATCACT
TCAGGCATGTGGATTTGGTCTGCCAAAACTCTTCACACGTGGCAGAAGTGTTCCAACAGATTGGTGAATT
CTGGAAAGGTAAAGAGAGAGAAGAGAGGAAATGGTTGGGTGAAGCCTGGAAAAGGCAGTGAGACTGTGGT
A


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC217286 representing NM_012193
Red=Cloning site Green=Tags(s)

MAWRGAGPSVPGAPGGVGLSLGLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHE
LQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWP
ESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGL
YSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERI
SCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIA
AWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLKIFMSLLVGIT
SGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012193
ORF Size 1611 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012193.1, NM_012193.2, NM_012193.3, NP_036325
RefSeq Size 7394
RefSeq ORF 1614
Locus ID 8322
Cytogenetics 11q14.2
Domains FRI, Frizzled
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Wnt signaling pathway, Melanogenesis, Pathways in cancer, Colorectal cancer, Basal cell carcinoma
MW 60.3 kDa
Gene Summary This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)