DPP6 (NM_001039350) Human Tagged ORF Clone

CAT#: RC216919

DPP6 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 6 (DPP6), transcript variant 3



  "NM_001039350" in other vectors (6)

Reconstitution Protocol

USD 733.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "DPP6"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DPP6
Synonyms DPL1; DPPX; MRD33; VF2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC216919 representing NM_001039350
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGAAAAGGCCATGATCAAGACCGCTAAGATGCAGGGGAACGTGATGGAGCTGGTGGGGAGTAACC
CTCCGCAGAGGAATTGGAAAGGAATAGCAATTGCACTGCTTGTCATTCTGGTCATCTGCTCCTTGATCGT
CACCTCGGTCATACTTCTGACACCAGCGGAAGATAATAGTCTGTCTCAAAAGAAGAAGGTCACTGTAGAA
GATCTCTTCAGTGAAGACTTCAAAATTCATGACCCCGAGGCTAAGTGGATAAGTGATACAGAATTCATCT
ACAGAGAACAGAAAGGAACAGTGAGACTGTGGAATGTTGAAACAAATACTTCTACTGTCTTAATAGAAGG
CAAAAAAATTGAATCATTAAGAGCCATCAGATATGAAATATCTCCAGATAGAGAGTATGCACTTTTTTCA
TACAATGTGGAACCCATATATCAACACTCGTATACTGGATATTATGTCCTGAGCAAAATTCCTCATGGGG
ATCCTCAAAGTCTGGACCCACCAGAAGTCAGCAATGCAAAACTTCAGTATGCAGGATGGGGCCCTAAAGG
CCAACAGCTGATATTTATTTTTGAAAACAATATCTACTACTGTGCACATGTCGGGAAACAGGCCATCCGT
GTGGTCTCCACTGGCAAGGAAGGTGTGATTTACAATGGCCTCAGTGACTGGCTGTATGAAGAGGAGATTT
TGAAGACACACATCGCACACTGGTGGTCTCCGGATGGCACGAGACTCGCCTACGCCGCCATCAATGATTC
CCGTGTCCCCATCATGGAGCTCCCAACTTACACCGGCTCCATCTACCCCACCGTGAAGCCCTACCACTAT
CCCAAGGCTGGAAGTGAGAACCCCAGCATTTCCCTACACGTTATTGGCTTAAATGGACCCACCCATGATC
TGGAGATGATGCCGCCTGATGATCCACGGATGAGGGAGTACTACATCACCATGGTGAAGTGGGCCACCAG
CACCAAGGTCGCCGTGACCTGGCTGAACCGGGCGCAGAACGTGTCCATCCTCACCCTCTGCGACGCCACC
ACGGGGGTCTGCACGAAGAAACACGAGGATGAAAGTGAGGCCTGGCTCCACAGACAGAATGAAGAACCTG
TGTTCTCCAAGGATGGCCGAAAGTTTTTCTTCATCAGAGCCATCCCCCAGGGAGGACGAGGGAAATTCTA
TCACATCACGGTGTCCTCGTCCCAGCCCAACAGCAGCAACGACAACATCCAGTCCATCACCTCCGGGGAC
TGGGACGTGACCAAGATCCTAGCCTACGATGAGAAGGGGAATAAGATCTACTTCCTGAGCACGGAGGACC
TGCCTCGGAGACGACAACTCTACAGTGCCAACACGGTGGGCAACTTCAACAGGCAGTGCCTCTCCTGTGA
CCTGGTTGAGAACTGCACCTACTTCAGCGCTTCCTTCAGCCATAGCATGGACTTCTTCCTGCTCAAGTGC
GAAGGTCCTGGTGTTCCTATGGTGACGGTGCACAACACAACAGATAAGAAAAAAATGTTTGACCTAGAAA
CAAATGAACATGTCAAGAAGGCCATAAATGACCGACAGATGCCTAAAGTGGAATACAGGGACATTGAGAT
TGATGATTACAACCTGCCCATGCAGATACTGAAGCCAGCAACCTTCACCGACACCACCCACTACCCTCTG
CTCCTGGTGGTGGATGGCACCCCGGGCAGCCAGAGTGTGGCTGAGAAGTTCGAGGTGAGCTGGGAGACGG
TGATGGTGAGCAGCCACGGCGCGGTGGTGGTAAAGTGTGACGGCCGTGGCAGCGGCTTCCAAGGGACCAA
GCTCCTGCACGAAGTGAGGCGGCGGCTGGGCTTGCTGGAGGAGAAGGACCAGATGGAGGCCGTGCGGACG
ATGCTGAAGGAGCAGTACATTGACAGGACGCGCGTGGCCGTGTTTGGGAAGGATTACGGTGGCTACCTGA
GCACCTACATCCTCCCAGCAAAGGGAGAAAATCAAGGCCAGACATTCACCTGCGGCTCTGCTCTCTCTCC
AATAACAGACTTCAAACTCTATGCCTCTGCGTTTTCCGAGAGGTACTTGGGCCTCCATGGACTTGACAAC
AGAGCATACGAGATGACCAAGGTAGCCCATCGAGTCTCCGCGCTGGAAGAACAGCAGTTCCTGATCATTC
ATCCCACTGCCGATGAAAAAATTCATTTCCAGCACACAGCAGAACTCATTACACAACTAATTAGGGGAAA
GGCTAATTACAGCTTACAGATTTACCCGGACGAAAGCCATTACTTTACCAGCTCCAGCCTCAAACAGCAT
CTGTACCGGTCCATCATCAACTTCTTCGTGGAATGCTTCAGGATCCAGGACAAACTGCTGACAGTCACAG
CGAAAGAGGACGAGGAGGAGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216919 representing NM_001039350
Red=Cloning site Green=Tags(s)

MKEKAMIKTAKMQGNVMELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPAEDNSLSQKKKVTVE
DLFSEDFKIHDPEAKWISDTEFIYREQKGTVRLWNVETNTSTVLIEGKKIESLRAIRYEISPDREYALFS
YNVEPIYQHSYTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIR
VVSTGKEGVIYNGLSDWLYEEEILKTHIAHWWSPDGTRLAYAAINDSRVPIMELPTYTGSIYPTVKPYHY
PKAGSENPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDAT
TGVCTKKHEDESEAWLHRQNEEPVFSKDGRKFFFIRAIPQGGRGKFYHITVSSSQPNSSNDNIQSITSGD
WDVTKILAYDEKGNKIYFLSTEDLPRRRQLYSANTVGNFNRQCLSCDLVENCTYFSASFSHSMDFFLLKC
EGPGVPMVTVHNTTDKKKMFDLETNEHVKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPL
LLVVDGTPGSQSVAEKFEVSWETVMVSSHGAVVVKCDGRGSGFQGTKLLHEVRRRLGLLEEKDQMEAVRT
MLKEQYIDRTRVAVFGKDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDN
RAYEMTKVAHRVSALEEQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQH
LYRSIINFFVECFRIQDKLLTVTAKEDEEED

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001039350
ORF Size 2403 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001039350.3
RefSeq Size 4571 bp
RefSeq ORF 2406 bp
Locus ID 1804
Cytogenetics 7q36.2
Protein Families Druggable Genome, Protease, Transmembrane
MW 91.1 kDa
Gene Summary This gene encodes a single-pass type II membrane protein that is a member of the peptidase S9B family of serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Variations in this gene may be associated with susceptibility to amyotrophic lateral sclerosis and with idiopathic ventricular fibrillation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]

Other Versions

{0} Product Review(s)

0 Product Review(s)

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.