APOBEC1 (NM_001644) Human Tagged ORF Clone

CAT#: RC215744

APOBEC1 (Myc-DDK-tagged)-Human apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1 (APOBEC1)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name APOBEC1 (NM_001644) Human Tagged ORF Clone
Symbol APOBEC1
Synonyms APOBEC-1; BEDP; CDAR1; HEPR
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC215744 representing NM_001644
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTTCTGAGAAAGGTCCTTCAACCGGTGACCCCACTCTGAGGAGAAGAATCGAACCCTGGGAGTTTG
ACGTCTTCTATGACCCCAGAGAACTTCGTAAAGAGGCCTGTCTGCTCTACGAAATCAAGTGGGGCATGAG
CCGGAAGATCTGGCGAAGCTCAGGCAAAAACACCACCAATCACGTGGAAGTTAATTTTATAAAAAAATTT
ACGTCAGAAAGAGATTTTCACCCATCCATCAGCTGCTCCATCACCTGGTTCTTGTCCTGGAGTCCCTGCT
GGGAATGCTCCCAGGCTATTAGAGAGTTTCTGAGTCGGCACCCTGGTGTGACTCTAGTGATCTACGTAGC
TCGGCTTTTTTGGCACATGGATCAACAAAATCGGCAAGGTCTCAGGGACCTTGTTAACAGTGGAGTAACT
ATTCAGATTATGAGAGCATCAGAGTATTATCACTGCTGGAGGAATTTTGTCAACTACCCACCTGGGGATG
AAGCTCACTGGCCACAATACCCACCTCTGTGGATGATGTTGTACGCACTGGAGCTGCACTGCATAATTCT
AAGTCTTCCACCCTGTTTAAAGATTTCAAGAAGATGGCAAAATCATCTTACATTTTTCAGACTTCATCTT
CAAAACTGCCATTACCAAACGATTCCGCCACACATCCTTTTAGCTACAGGGCTGATACATCCTTCTGTGG
CTTGGAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215744 representing NM_001644
Red=Cloning site Green=Tags(s)

MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKF
TSERDFHPSISCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLVNSGVT
IQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHL
QNCHYQTIPPHILLATGLIHPSVAWR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001644
ORF Size 708 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001644.1, NM_001644.2, NM_001644.3, NM_001644.4, NP_001635
RefSeq Size 911
RefSeq ORF 711
Locus ID 339
Cytogenetics 12p13.31
MW 28 kDa
Gene Summary This gene encodes a member of the cytidine deaminase enzyme family. The encoded protein forms a multiple-protein editing holoenzyme with APOBEC1 complementation factor (ACF) and APOBEC1 stimulating protein (ASP). This holoenzyme is involved in the editing of C-to-U nucleotide bases in apolipoprotein B and neurofibromatosis-1 mRNAs. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)