COPA (NM_001098398) Human Tagged ORF Clone

CAT#: RC214199

COPA (Myc-DDK-tagged)-Human coatomer protein complex, subunit alpha (COPA), transcript variant 1

Clone Modification / Custom Cloning Service

USD 869.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name COPA (NM_001098398) Human Tagged ORF Clone
Symbol COPA
Synonyms AILJK; HEP-COP
Vector pCMV6-Entry
Sequence Data
>RC214199 representing NM_001098398
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTAACCAAATTCGAGACCAAGAGCGCGCGGGTCAAAGGGCTCAGCTTTCACCCCAAAAGACCTTGGA
TCCTGACTAGTTTACATAATGGGGTCATCCAGTTATGGGACTATCGGATGTGCACTCTCATTGACAAGTT
TGATGAACATGATGGTCCAGTGCGAGGCATTGACTTCCATAAGCAGCAGCCACTGTTCGTCTCTGGAGGA
GATGACTATAAGATTAAGGTTTGGAATTACAAGCTTCGGCGCTGTCTTTTCACATTGCTTGGGCACTTAG
ATTATATTCGCACCACGTTTTTTCATCATGAATATCCCTGGATTCTGAGTGCCTCCGATGATCAGACCAT
CCGAGTGTGGAATTGGCAATCTAGAACCTGTGTTTGTGTGTTAACAGGGCACAACCATTATGTGATGTGT
GCTCAGTTCCACCCCACAGAAGACTTGGTAGTATCAGCCAGCCTGGACCAGACTGTGCGCGTTTGGGATA
TTTCTGGTCTGAGGAAAAAAAACCTGTCCCCTGGTGCGGTGGAATCGGATGTGAGAGGAATAACTGGGGT
TGATCTATTTGGAACTACAGATGCAGTGGTGAAGCATGTACTAGAGGGTCACGATCGTGGAGTAAACTGG
GCTGCCTTCCACCCCACTATGCCCCTTATTGTATCTGGGGCAGATGATCGTCAAGTGAAGATCTGGCGCA
TGAATGAATCAAAGGCATGGGAGGTTGATACCTGCCGGGGCCATTACAACAATGTATCTTGTGCCGTCTT
CCACCCTCGCCAAGAGTTGATCCTCAGCAATTCTGAGGACAAGAGTATTCGAGTCTGGGATATGTCTAAG
CGGACTGGGGTTCAGACTTTCCGCAGAGACCATGATCGTTTCTGGGTCCTAGCTGCTCACCCTAACCTTA
ACCTCTTTGCAGCAGGCCATGATGGTGGTATGATTGTGTTTAAGCTGGAACGGGAACGGCCAGCCTATGC
TGTTCATGGCAATATGCTACACTATGTCAAGGACCGATTCTTACGACAGCTGGATTTCAACAGCTCCAAA
GATGTAGCTGTGATGCAGTTGCGGAGTGGTTCCAAGTTTCCAGTATTCAATATGTCATACAATCCAGCAG
AAAATGCAGTCCTGCTTTGTACAAGAGCTAGCAATCTAGAGAATAGTACCTATGACCTGTACACCATCCC
TAAAGATGCTGACTCCCAGAATCCTGATGCGCCTGAAGGGAAACGATCCTCAGGCCTGACAGCCGTTTGG
GTCGCTCGAAATCGGTTTGCTGTCCTAGATCGGATGCATTCGCTTCTGATCAAGAATCTGAAGAATGAGA
TCACCAAAAAGGTACAGGTGCCCAACTGTGATGAGATCTTCTATGCTGGCACAGGCAATCTCCTGCTTCG
AGATGCGGACTCTATCACACTCTTTGACGTACAGCAGAAGCGGACTCTGGCATCTGTGAAGATTTCTAAA
GTGAAATACGTTATCTGGTCAGCAGACATGTCACATGTAGCACTACTAGCCAAACACGAACACTCATGCC
CTTTGCCTCTTACAGCCATTGTGATCTGTAACCGCAAACTGGATGCTTTATGTAACATTCATGAGAACAT
TCGTGTCAAGAGTGGGGCCTGGGATGAGAGTGGGGTATTTATCTATACCACAAGCAACCACATCAAATAT
GCTGTCACCACTGGGGACCACGGGATCATTCGAACTCTGGATTTACCCATCTATGTCACACGGGTGAAGG
GCAACAATGTATACTGCCTAGACAGGGAGTGTCGTCCCCGGGTACTCACCATTGATCCCACTGAGTTCAA
ATTCAAGCTGGCCCTGATCAACAGAAAATATGATGAGGTACTGCACATGGTGAGGAATGCCAAACTAGTT
GGCCAGTCTATTATTGCTTATCTCCAGAAGAAGGGCTATCCTGAAGTGGCACTGCATTTTGTCAAGGATG
AGAAAACTCGCTTTAGTCTGGCACTGGAGTGTGGAAACATTGAGATTGCTCTGGAAGCAGCCAAAGCACT
GGATGACAAGAACTGCTGGGAAAAGCTGGGAGAAGTGGCCCTGCTGCAGGGGAACCACCAGATTGTGGAA
ATGTGCTATCAGCGTACCAAAAACTTTGACAAACTTTCCTTCCTGTATCTTATCACTGGCAACTTAGAAA
AACTTCGCAAGATGATGAAGATTGCTGAGATCAGAAAGGACATGAGTGGCCACTATCAGAATGCCCTATA
CCTGGGTGATGTGTCAGAGCGTGTGCGGATCCTGAAGAACTGTGGACAGAAGTCCCTGGCCTATCTCACA
GCTGCTACCCATGGCTTAGATGAAGAAGCTGAGAGCCTAAAGGAGACATTTGACCCAGAGAAGGAGACAA
TCCCAGACATTGACCCTAATGCCAAGCTGCTCCAGCCACCTGCACCTATCATGCCATTGGATACCAATTG
GCCTTTATTGACTGTATCCAAAGGATTTTTTGAAGGCACCATTGCCAGCAAAGGGAAGGGAGGAGCACTG
GCTGCTGACATTGACATTGACACTGTTGGTACAGAGGGCTGGGGAGAGGATGCAGAGCTGCAGTTGGATG
AAGATGGGTTTGTGGAGGCTACAGAAGGTTTGGGGGATGATGCTCTTGGCAAGGGACAGGAAGAAGGAGG
TGGCTGGGATGTAGAAGAAGATCTGGAGCTCCCTCCTGAGCTGGATATATCCCCTGGGGCAGCTGGTGGG
GCTGAAGATGGTTTCTTTGTGCCCCCAACCAAGGGAACAAGTCCAACTCAGATCTGGTGTAATAACTCTC
AGCTTCCAGTTGATCACATCCTGGCAGGCTCTTTCGAAACAGCCATGCGGCTCCTTCATGACCAAGTAGG
GGTAATCCAGTTTGGCCCCTACAAGCAACTGTTCCTACAGACATACGCCCGAGGCCGCACAACCTATCAG
GCTCTGCCCTGCCTACCCTCCATGTATGGCTATCCTAATCGCAACTGGAAGGATGCAGGGCTGAAGAATG
GTGTACCAGCTGTGGGCCTGAAGCTTAATGACCTCATCCAACGGTTGCAGCTGTGCTACCAGCTCACCAC
AGTTGGCAAATTTGAGGAGGCTGTGGAAAAATTCCGTTCCATCCTTCTCAGTGTGCCACTTCTTGTTGTG
GACAATAAACAAGAGATTGCAGAGGCCCAGCAGCTCATCACCATTTGCCGTGAGTACATTGTGGGTTTGT
CCGTGGAGACAGAAAGGAAGAAGCTGCCCAAAGAGACTCTAGAACAGCAGAAGCGCATCTGTGAGATGGC
AGCCTATTTCACCCACTCAAACCTGCAGCCTGTGCACATGATCCTGGTGCTGCGTACAGCCCTCAATCTG
TTCTTCAAGCTCAAGAACTTCAAGACAGCTGCCACCTTTGCTCGGCGCCTACTAGAACTCGGGCCCAAGC
CTGAGGTGGCCCAACAGACCCGAAAAATCCTGTCTGCCTGTGAGAAGAATCCCACAGATGCCTACCAGCT
CAATTATGACATGCACAACCCCTTTGACATTTGTGCTGCATCATATCGGCCCATCTACCGTGGAAAGCCA
GTAGAAAAGTGTCCACTCAGTGGGGCCTGCTATTCCCCTGAGTTCAAAGGTCAAATCTGCAGGGTCACCA
CAGTGACAGAGATTGGCAAAGATGTGATTGGTTTAAGGATCAGTCCTCTGCAGTTTCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214199 representing NM_001098398
Red=Cloning site Green=Tags(s)

MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGG
DDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMC
AQFHPTEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESDVRGITGVDLFGTTDAVVKHVLEGHDRGVNW
AAFHPTMPLIVSGADDRQVKIWRMNESKAWEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSK
RTGVQTFRRDHDRFWVLAAHPNLNLFAAGHDGGMIVFKLERERPAYAVHGNMLHYVKDRFLRQLDFNSSK
DVAVMQLRSGSKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVW
VARNRFAVLDRMHSLLIKNLKNEITKKVQVPNCDEIFYAGTGNLLLRDADSITLFDVQQKRTLASVKISK
VKYVIWSADMSHVALLAKHEHSCPLPLTAIVICNRKLDALCNIHENIRVKSGAWDESGVFIYTTSNHIKY
AVTTGDHGIIRTLDLPIYVTRVKGNNVYCLDRECRPRVLTIDPTEFKFKLALINRKYDEVLHMVRNAKLV
GQSIIAYLQKKGYPEVALHFVKDEKTRFSLALECGNIEIALEAAKALDDKNCWEKLGEVALLQGNHQIVE
MCYQRTKNFDKLSFLYLITGNLEKLRKMMKIAEIRKDMSGHYQNALYLGDVSERVRILKNCGQKSLAYLT
AATHGLDEEAESLKETFDPEKETIPDIDPNAKLLQPPAPIMPLDTNWPLLTVSKGFFEGTIASKGKGGAL
AADIDIDTVGTEGWGEDAELQLDEDGFVEATEGLGDDALGKGQEEGGGWDVEEDLELPPELDISPGAAGG
AEDGFFVPPTKGTSPTQIWCNNSQLPVDHILAGSFETAMRLLHDQVGVIQFGPYKQLFLQTYARGRTTYQ
ALPCLPSMYGYPNRNWKDAGLKNGVPAVGLKLNDLIQRLQLCYQLTTVGKFEEAVEKFRSILLSVPLLVV
DNKQEIAEAQQLITICREYIVGLSVETERKKLPKETLEQQKRICEMAAYFTHSNLQPVHMILVLRTALNL
FFKLKNFKTAATFARRLLELGPKPEVAQQTRKILSACEKNPTDAYQLNYDMHNPFDICAASYRPIYRGKP
VEKCPLSGACYSPEFKGQICRVTTVTEIGKDVIGLRISPLQFR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001098398
ORF Size 3699 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001098398.1, NP_001091868
RefSeq Size 5666
RefSeq ORF 3702
Locus ID 1314
Cytogenetics 1q23.2
MW 139.1 kDa
Gene Summary In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). Seven coat proteins have been identified, and they represent subunits of a complex known as coatomer. The subunits are designated alpha-COP, beta-COP, beta-prime-COP, gamma-COP, delta-COP, epsilon-COP, and zeta-COP. The alpha-COP, encoded by COPA, shares high sequence similarity with RET1P, the alpha subunit of the coatomer complex in yeast. Also, the N-terminal 25 amino acids of alpha-COP encode the bioactive peptide, xenin, which stimulates exocrine pancreatic secretion and may act as a gastrointestinal hormone. Alternative splicing results in multiple splice forms encoding distinct isoforms. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)