FXYD3 (NM_005971) Human Tagged ORF Clone
CAT#: RC213945
FXYD3 (Myc-DDK-tagged)-Human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 1
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_005971" in other vectors (4)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | FXYD3 |
Synonyms | MAT8; PLML |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC213945 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCAGAAGGTGACCCTGGGCCTGCTTGTGTTCCTGGCAGGCTTTCCTGTCCTGGACGCCAATGACCTAG AAGATAAAAACAGTCCTTTCTACTATGACTGGCACAGCCTCCAGGTTGGCGGGCTCATCTGCGCTGGGGT TCTGTGCGCCATGGGCATCATCATCGTCATGAGTGCAAAATGCAAATGCAAGTTTGGCCAGAAGTCCGGT CACCATCCAGGGGAGACTCCACCTCTCATCACCCCAGGCTCAGCCCAAAGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC213945 protein sequence
Red=Cloning site Green=Tags(s) MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSG HHPGETPPLITPGSAQS myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_005971 |
ORF Size | 261 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_005971.4 |
RefSeq Size | 1382 bp |
RefSeq ORF | 264 bp |
Locus ID | 5349 |
UniProt ID | Q14802 |
Cytogenetics | 19q13.12 |
Domains | ATP1G1_PLM_MAT8 |
Protein Families | Ion Channels: Other, Transmembrane |
MW | 9.3 kDa |
Gene Summary | This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Oct 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC213945L3 | Lenti ORF clone of Human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 1, Myc-DDK-tagged |
USD 450.00 |
|
RC213945L4 | Lenti ORF clone of Human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 1, mGFP tagged |
USD 450.00 |
|
RG213945 | FXYD3 (tGFP-tagged) - Human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 1 |
USD 350.00 |
|
SC116402 | FXYD3 (untagged)-Human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 1 |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review