NR5A2 (NM_003822) Human Tagged ORF Clone

CAT#: RC213887

Reviews ()
Write a review

NR5A2 (Myc-DDK-tagged)-Human nuclear receptor subfamily 5, group A, member 2 (NR5A2), transcript variant 2



  "NM_003822" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 457.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "NR5A2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NR5A2
Synonyms B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta; hB1F-2; LRH-1; LRH1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC213887 representing NM_003822
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTTCTAATTCAGATACTGGGGATTTACAAGAGTCTTTAAAGCACGGACTTACACCTATTGTGTCTC
AATTTAAAATGGTGAATTACTCCTATGATGAAGATCTGGAAGAGCTTTGTCCCGTGTGTGGAGATAAAGT
GTCTGGGTACCATTATGGGCTCCTCACCTGTGAAAGCTGCAAGGGATTTTTTAAGCGAACAGTCCAAAAT
AATAAAAGGTACACATGTATAGAAAACCAGAACTGCCAAATTGACAAAACACAGAGAAAGCGTTGTCCTT
ACTGTCGTTTTCAAAAATGTCTAAGTGTTGGAATGAAGCTAGAAGCTGTAAGGGCCGACCGAATGCGTGG
AGGAAGGAATAAGTTTGGGCCAATGTACAAGAGAGACAGGGCCCTGAAGCAACAGAAAAAAGCCCTCATC
CGAGCCAATGGACTTAAGCTAGAAGCCATGTCTCAGGTGATCCAAGCTATGCCCTCTGACCTGACCATTT
CCTCTGCAATTCAAAACATCCACTCTGCCTCCAAAGGCCTACCTCTGAACCATGCTGCCTTGCCTCCTAC
AGACTATGACAGAAGTCCCTTTGTAACATCCCCCATTAGCATGACAATGCCCCCTCACGGCAGCCTGCAA
GGTTACCAAACACATGGCCACTTTCCTAGCCGGGCCATCAAGTCTGAGTACCCAGACCCCTATACCAGCT
CACCCGAGTCCATAATGGGCTATTCATATATGGATAGTTACCAGACGAGCTCTCCAGCAAGCATCCCACA
TCTGATACTGGAACTTTTGAAGTGTGAGCCAGATGAGCCTCAAGTCCAGGCTAAAATCATGGCCTATTTG
CAGCAAGAGCAGGCTAACCGAAGCAAGCACGAAAAGCTGAGCACCTTTGGGCTTATGTGCAAAATGGCAG
ATCAAACTCTCTTCTCCATTGTCGAGTGGGCCAGGAGTAGTATCTTCTTCAGAGAACTTAAGGTTGATGA
CCAAATGAAGCTGCTTCAGAACTGCTGGAGTGAGCTCTTAATCCTCGACCACATTTACCGACAAGTGGTA
CATGGAAAGGAAGGATCCATCTTCCTGGTTACTGGGCAACAAGTGGACTATTCCATAATAGCATCACAAG
CCGGAGCCACCCTCAACAACCTCATGAGTCATGCACAGGAGTTAGTGGCAAAACTTCGTTCTCTCCAGTT
TGATCAACGAGAGTTCGTATGTCTGAAATTCTTGGTGCTCTTTAGTTTAGATGTCAAAAACCTTGAAAAC
TTCCAGCTGGTAGAAGGTGTCCAGGAACAAGTCAATGCCGCCCTGCTGGACTACACAATGTGTAACTACC
CGCAGCAGACAGAGAAATTTGGACAGCTACTTCTTCGACTACCCGAAATCCGGGCCATCAGTATGCAGGC
TGAAGAATACCTCTACTACAAGCACCTGAACGGGGATGTGCCCTATAATAACCTTCTCATTGAAATGTTG
CATGCCAAAAGAGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213887 representing NM_003822
Red=Cloning site Green=Tags(s)

MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQN
NKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALI
RANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQ
GYQTHGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYL
QQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVV
HGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLEN
FQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEML
HAKRA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003822
ORF Size 1485 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003822.5
RefSeq Size 4916 bp
RefSeq ORF 1488 bp
Locus ID 2494
UniProt ID O00482
Cytogenetics 1q32.1
Domains HOLI, zf-C4
Protein Families Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
Protein Pathways Maturity onset diabetes of the young
MW 56.3 kDa
Gene Summary The protein encoded by this gene is a DNA-binding zinc finger transcription factor and is a member of the fushi tarazu factor-1 subfamily of orphan nuclear receptors. The encoded protein is involved in the expression of genes for hepatitis B virus and cholesterol biosynthesis, and may be an important regulator of embryonic development. [provided by RefSeq, Jun 2016]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.