PLA2R (PLA2R1) (NM_001007267) Human Tagged ORF Clone

CAT#: RC213576

Reviews ()
Write a review

PLA2R1 (Myc-DDK-tagged)-Human phospholipase A2 receptor 1, 180kDa (PLA2R1), transcript variant 2



Reconstitution Protocol

USD 1,728.00

In Stock*

Size
    • 10 ug

Product images

Other products for "PLA2R1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PLA2R1
Synonyms CLEC13C; PLA2-R; PLA2G1R; PLA2IR; PLA2R
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC213576 representing NM_001007267
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCTGTCGCCGTCGCTGCTGCTGCTGCTGCTGCTGGGGGCGCCGCGGGGCTGCGCCGAGGGTGTGG
CGGCGGCGCTTACCCCCGAGCGGCTCCTGGAGTGGCAGGATAAAGGAATATTTGTTATCCAAAGTGAGAG
TCTCAAGAAATGCATTCAAGCAGGTAAATCGGTTCTGACCCTGGAGAACTGCAAGCAAGCAAACAAGCAC
ATGCTGTGGAAATGGGTTTCAAACCATGGCCTCTTTAACATAGGAGGCAGTGGTTGCCTGGGCCTGAATT
TCTCCGCCCCAGAGCAGCCATTAAGCTTATATGAATGTGACTCCACCCTCGTTTCCTTACGGTGGCGCTG
TAACAGGAAGATGATCACAGGCCCGCTGCAGTACTCTGTCCAGGTGGCGCATGACAACACAGTGGTGGCC
TCACGGAAGTATATTCATAAGTGGATTTCTTATGGGTCAGGTGGTGGAGACATTTGTGAATATCTACACA
AAGATTTGCATACAATCAAAGGGAACACCCACGGGATGCCGTGTATGTTTCCCTTCCAGTATAACCATCA
GTGGCATCATGAATGTACCCGTGAAGGTCGGGAAGATGACTTACTGTGGTGTGCCACGACAAGCCGTTAT
GAAAGAGATGAAAAGTGGGGATTTTGCCCTGATCCCACCTCTGCAGAAGTAGGTTGTGATACTATTTGGG
AGAAGGACCTCAATTCACACATTTGCTACCAGTTCAACCTGCTTTCATCTCTCTCTTGGAGTGAGGCACA
TTCTTCATGCCAGATGCAAGGAGGTACGCTGTTAAGTATTACAGATGAAACTGAAGAAAATTTCATAAGG
GAGCACATGAGCAGTAAAACAGTGGAGGTGTGGATGGGCCTCAATCAGCTGGATGAACACGCTGGCTGGC
AGTGGTCTGATGGAACGCCGCTCAACTATCTGAATTGGAGCCCAGAGGTAAATTTTGAGCCATTTGTTGA
AGATCACTGTGGAACATTTAGTTCATTTATGCCAAGTGCCTGGAGGAGTCGGGATTGTGAGTCCACCTTG
CCATATATATGTAAAAAATATCTAAACCACATTGATCATGAAATAGTTGAAAAAGATGCGTGGAAATATT
ATGCTACCCACTGTGAGCCTGGCTGGAATCCCTACAATCGTAATTGCTACAAACTTCAGAAAGAAGAAAA
GACCTGGCATGAGGCTCTGCGTTCTTGTCAGGCTGATAACAGTGCATTAATAGACATAACCTCATTAGCA
GAGGTGGAGTTTCTTGTAACCCTCCTTGGAGATGAAAATGCATCAGAAACATGGATTGGTTTGAGCAGCA
ATAAAATTCCAGTTTCCTTTGAATGGTCTAATGACTCTTCAGTCATCTTTACTAATTGGCACACACTTGA
GCCCCACATTTTTCCAAATAGAAGCCAGCTGTGTGTCTCAGCAGAGCAGTCTGAGGGACACTGGAAAGTC
AAAAATTGTGAAGAAAGACTTTTTTACATTTGTAAAAAAGCAGGCCATGTCCTCTCTGATGCTGAATCAG
GATGTCAAGAGGGATGGGAGAGACATGGTGGATTCTGTTACAAAATTGACACAGTCCTTCGAAGCTTTGA
CCAAGCTTCCAGCGGTTATTACTGTCCTCCTGCACTTGTAACCATTACAAACAGGTTTGAACAGGCTTTT
ATTACCAGTTTGATCAGTAGTGTGGTAAAAATGAAGGACAGTTATTTTTGGATAGCTCTTCAGGACCAAA
ATGATACGGGAGAATACACTTGGAAGCCAGTAGGGCAGAAACCCGAGCCGGTGCAGTACACACACTGGAA
CACACACCAGCCGCGCTACAGTGGTGGCTGTGTTGCCATGCGAGGAAGGCATCCACTTGGTCGCTGGGAA
GTGAAGCACTGTCGGCACTTTAAGGCAATGTCCTTGTGCAAGCAGCCAGTTGAAAATCAGGAAAAAGCAG
AGTATGAAGAGAGATGGCCCTTTCACCCCTGCTATTTGGACTGGGAGTCAGAGCCTGGTCTGGCCAGTTG
CTTCAAGGTATTTCATAGTGAAAAAGTTCTGATGAAAAGAACATGGAGAGAAGCTGAAGCATTTTGCGAA
GAATTTGGAGCTCATCTTGCAAGCTTTGCCCATATTGAGGAAGAGAATTTTGTGAATGAGCTCTTACATT
CAAAATTTAATTGGACAGAAGAAAGGCAGTTCTGGATTGGATTTAATAAAAGAAACCCACTGAATGCCGG
CTCATGGGAGTGGTCTGATAGAACTCCTGTTGTCTCTTCGTTTTTAGACAACACTTATTTTGGAGAAGAT
GCAAGAAACTGTGCTGTTTATAAGGCAAACAAAACATTGCTGCCCTTACACTGTGGTTCCAAACGTGAAT
GGATATGCAAAATCCCAAGAGATGTGAAACCCAAGATTCCGTTCTGGTACCAGTACGATGTACCCTGGCT
CTTTTATCAGGATGCAGAATACCTTTTTCATACCTTTGCCTCAGAATGGTTGAACTTTGAGTTTGTCTGT
AGCTGGCTGCACAGTGATCTTCTCACAATTCATTCTGCACATGAGCAAGAATTCATCCACAGCAAAATAA
AAGCGCTATCAAAGTATGGTGCAAGTTGGTGGATTGGACTTCAAGAAGAAAGAGCCAATGATGAATTTCG
CTGGAGAGATGGAACACCAGTGATATACCAGAACTGGGACACAGGAAGAGAAAGAACTGTGAATAATCAG
AGCCAGAGATGTGGCTTTATTTCTTCTATAACAGGACTCTGGGGTAGTGAAGAGTGTTCAGTTTCTATGC
CTAGTATCTGTAAGCGAAAAAAGGTTTGGCTCATAGAGAAAAAGAAAGATACACCAAAACAACATGGAAC
GTGTCCCAAAGGATGGCTATATTTTAACTATAAGTGCCTTCTGCTGAATATCCCCAAAGACCCAAGCAGT
TGGAAGAACTGGACGCATGCTCAACATTTCTGTGCTGAAGAAGGGGGGACCCTGGTCGCCATTGAAAGTG
AGGTGGAGCAAGCTTTCATTACTATGAATCTTTTTGGCCAGACCACCAGTGTGTGGATAGGTTTACAAAA
TGATGATTATGAAACATGGCTAAATGGAAAGCCTGTGGTATATTCTAACTGGTCTCCATTTGATATAATA
AATATTCCAAGTCACAATACCACTGAAGTTCAGAAACACATTCCTCTCTGTGCCTTACTCTCAAGTAATC
CTAATTTTCATTTCACTGGAAAATGGTATTTTGAAGACTGTGGAAAGGAAGGCTATGGGTTTGTTTGTGA
AAAAATGCAAGATACTTCTGGACACGGTGTAAATACATCTGATATGTATCCAATGCCCAATACCTTAGAA
TATGGAAACAGAACTTACAAAATAATTAATGCAAATATGACTTGGTATGCAGCAATAAAAACCTGCCTGA
TGCACAAAGCACAACTGGTCAGCATCACAGACCAGTATCACCAGTCCTTCCTCACTGTTGTCCTCAACCG
GCTAGGATATGCCCACTGGATTGGACTGTTCACCACAGATAATGGTCTTAATTTTGACTGGTCTGATGGC
ACCAAATCTTCTTTCACTTTTTGGAAAGATGAGGAGTCCTCCCTCCTTGGTGACTGCGTTTTTGCCGACA
GCAACGGACGCTGGCATAGCACAGCCTGCGAGTCATTTCTGCAAGGTGCCATTTGTCATGTGCCACCTGA
AACAAGACAATCTGAACACCCAGAGTTGTGCTCAGAAACATCTATTCCCTGGATAAAATTTAAAAGTAAT
TGCTACAGTTTTTCTACAGTCCTAGACAGTATGAGTTTTGAGGCTGCTCATGAATTTTGCAAAAAGGAAG
GTTCTAATCTTTTAACAATCAAGGATGAGGCTGAAAATGCATTTCTCCTAGAAGAGCTGTTTGCTTTTGG
TTCTTCTGTCCAGATGGTTTGGTTGAATGCTCAATTTGATGGTAACAGTAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213576 representing NM_001007267
Red=Cloning site Green=Tags(s)

MLLSPSLLLLLLLGAPRGCAEGVAAALTPERLLEWQDKGIFVIQSESLKKCIQAGKSVLTLENCKQANKH
MLWKWVSNHGLFNIGGSGCLGLNFSAPEQPLSLYECDSTLVSLRWRCNRKMITGPLQYSVQVAHDNTVVA
SRKYIHKWISYGSGGGDICEYLHKDLHTIKGNTHGMPCMFPFQYNHQWHHECTREGREDDLLWCATTSRY
ERDEKWGFCPDPTSAEVGCDTIWEKDLNSHICYQFNLLSSLSWSEAHSSCQMQGGTLLSITDETEENFIR
EHMSSKTVEVWMGLNQLDEHAGWQWSDGTPLNYLNWSPEVNFEPFVEDHCGTFSSFMPSAWRSRDCESTL
PYICKKYLNHIDHEIVEKDAWKYYATHCEPGWNPYNRNCYKLQKEEKTWHEALRSCQADNSALIDITSLA
EVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKV
KNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKIDTVLRSFDQASSGYYCPPALVTITNRFEQAF
ITSLISSVVKMKDSYFWIALQDQNDTGEYTWKPVGQKPEPVQYTHWNTHQPRYSGGCVAMRGRHPLGRWE
VKHCRHFKAMSLCKQPVENQEKAEYEERWPFHPCYLDWESEPGLASCFKVFHSEKVLMKRTWREAEAFCE
EFGAHLASFAHIEEENFVNELLHSKFNWTEERQFWIGFNKRNPLNAGSWEWSDRTPVVSSFLDNTYFGED
ARNCAVYKANKTLLPLHCGSKREWICKIPRDVKPKIPFWYQYDVPWLFYQDAEYLFHTFASEWLNFEFVC
SWLHSDLLTIHSAHEQEFIHSKIKALSKYGASWWIGLQEERANDEFRWRDGTPVIYQNWDTGRERTVNNQ
SQRCGFISSITGLWGSEECSVSMPSICKRKKVWLIEKKKDTPKQHGTCPKGWLYFNYKCLLLNIPKDPSS
WKNWTHAQHFCAEEGGTLVAIESEVEQAFITMNLFGQTTSVWIGLQNDDYETWLNGKPVVYSNWSPFDII
NIPSHNTTEVQKHIPLCALLSSNPNFHFTGKWYFEDCGKEGYGFVCEKMQDTSGHGVNTSDMYPMPNTLE
YGNRTYKIINANMTWYAAIKTCLMHKAQLVSITDQYHQSFLTVVLNRLGYAHWIGLFTTDNGLNFDWSDG
TKSSFTFWKDEESSLLGDCVFADSNGRWHSTACESFLQGAICHVPPETRQSEHPELCSETSIPWIKFKSN
CYSFSTVLDSMSFEAAHEFCKKEGSNLLTIKDEAENAFLLEELFAFGSSVQMVWLNAQFDGNSK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001007267
ORF Size 3972 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001007267.2, NP_001007268.1
RefSeq Size 5160 bp
RefSeq ORF 3975 bp
Locus ID 22925
UniProt ID Q13018
Cytogenetics 2q24.2
Protein Families Druggable Genome, Transmembrane
MW 152.81 kDa
Gene Summary This gene represents a phospholipase A2 receptor. The encoded protein likely exists as both a transmembrane form and a soluble form. The transmembrane receptor may play a role in clearance of phospholipase A2, thereby inhibiting its action. Polymorphisms at this locus have been associated with susceptibility to idiopathic membranous nephropathy. Alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Sep 2010]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.