KCNAB3 (NM_004732) Human Tagged ORF Clone

CAT#: RC213514

Reviews ()
Write a review

KCNAB3 (Myc-DDK-tagged)-Human potassium voltage-gated channel, shaker-related subfamily, beta member 3 (KCNAB3)



  "NM_004732" in other vectors (6)

Reward yourself with an Amazon® Card when get any 3 cDNA clones.

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name KCNAB3 (NM_004732) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KCNAB3
Synonyms AKR6A9; KCNA3.1B; KCNA3B; KV-BETA-3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC213514 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGTGTCTATCGCGTGTACCGAGCAGAACCTTCGCAGCCGGAGCAGTGAGGACCGTCTGTGTGGAC
CCCGGCCGGGCCCCGGGGGCGGTAATGGTGGGCCGGCCGGCGGGGGGCACGGGAATCCTCCGGGGGGTGG
AGGGTCTGGCCCCAAGGCCCGAGCTGCACTGGTTCCCCGACCCCCAGCGCCCGCTGGGGCCCTCCGAGAG
AGCACCGGCCGAGGCACTGGCATGAAATACAGGAACCTAGGGAAGTCTGGTCTTCGGGTATCCTGTCTTG
GCCTAGGTACCTGGGTCACATTTGGTTCTCAGATCTCAGATGAGACAGCAGAGGATGTGCTGACTGTAGC
CTATGAGCATGGTGTAAACCTGTTTGACACCGCCGAAGTGTACGCAGCAGGAAAGGCTGAAAGAACCCTA
GGGAACATCCTCAAGAGCAAAGGTTGGAGGAGATCAAGCTATGTCATCACTACCAAGATTTTTTGGGGAG
GACAGGCAGAAACCGAGCGAGGTTTAAGCCGAAAGCACATCATTGAGGGCTTGCGAGGATCCCTGGAACG
CCTCCAGCTGGGATACGTGGACATTGTCTTTGCCAATCGCTCAGACCCCAACTGTCCTATGGAGGAGATT
GTGCGAGCCATGACCTATGTCATCAACCAGGGCCTGGCCCTATACTGGGGGACATCCCGATGGGGGGCTG
CAGAAATCATGGAGGCCTACTCCATGGCCAGACAGTTCAATCTGATTCCTCCAGTGTGTGAACAAGCGGA
GCACCATCTGTTTCAGAGGGAGAAGGTGGAGATGCAGCTGCCAGAGCTCTACCACAAGATTGGAGTTGGA
TCAGTCACTTGGTACCCTCTAGCCTGTGGTCTCATTACTAGCAAGTATGATGGGCGAGTCCCAGATACTT
GCAGGGCCTCCATCAAGGGCTACCAGTGGCTCAAGGACAAAGTGCAGAGTGAAGATGGCAAGAAGCAACA
AGCCAAAGTCATGGACCTTCTTCCTGTCGCTCACCAGCTGGGCTGCACCGTGGCCCAGCTTGCTATTGCG
TGGTGTCTCCGCAGTGAGGGTGTCAGCTCTGTCTTGCTGGGGGTGTCGAGTGCGGAGCAGTTGATAGAAC
ACCTGGGCGCGCTACAGGTGCTGAGCCAGCTGACCCCGCAGACAGTGATGGAAATAGACGGGCTCCTGGG
AAACAAGCCGCATTCCAAGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213514 protein sequence
Red=Cloning site Green=Tags(s)

MQVSIACTEQNLRSRSSEDRLCGPRPGPGGGNGGPAGGGHGNPPGGGGSGPKARAALVPRPPAPAGALRE
STGRGTGMKYRNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEVYAAGKAERTL
GNILKSKGWRRSSYVITTKIFWGGQAETERGLSRKHIIEGLRGSLERLQLGYVDIVFANRSDPNCPMEEI
VRAMTYVINQGLALYWGTSRWGAAEIMEAYSMARQFNLIPPVCEQAEHHLFQREKVEMQLPELYHKIGVG
SVTWYPLACGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQLGCTVAQLAIA
WCLRSEGVSSVLLGVSSAEQLIEHLGALQVLSQLTPQTVMEIDGLLGNKPHSKK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_004732
ORF Size 1212 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004732.1, NM_004732.2, NM_004732.3, NP_004723.2
RefSeq Size 2458 bp
RefSeq ORF 1215 bp
Locus ID 9196
Cytogenetics 17p13.1
Protein Families Druggable Genome, Ion Channels: Other
MW 43.7 kDa
Gene Summary This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. The encoded protein is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. The encoded protein forms a heterodimer with the potassium voltage-gated channel, shaker-related subfamily, member 5 gene product and regulates the activity of the alpha subunit. [provided by RefSeq, May 2012]

Other Versions

Other products for "KCNAB3"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-KCNAB3 Antibody
    • 100 ul

USD 310.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools