AIRE (NM_000383) Human Tagged ORF Clone

CAT#: RC213497

AIRE (Myc-DDK-tagged)-Human autoimmune regulator (AIRE), transcript variant AIRE-1

Need custom modification / cloning service?
Get a free quote

USD 701.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name AIRE (NM_000383) Human Tagged ORF Clone
Symbol AIRE
Synonyms AIRE1; APECED; APS1; APSI; PGA1
Vector pCMV6-Entry
Sequence Data
>RC213497 representing NM_000383
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGACGGACGCGGCGCTACGCCGGCTTCTGAGGCTGCACCGCACGGAGATCGCGGTGGCCGTGGACA
GCGCCTTCCCACTGCTGCACGCGCTGGCTGACCACGACGTGGTCCCCGAGGACAAGTTTCAGGAGACGCT
TCATCTGAAGGAAAAGGAGGGCTGCCCCCAGGCCTTCCACGCCCTCCTGTCCTGGCTGCTGACCCAGGAC
TCCACAGCCATCCTGGACTTCTGGAGGGTGCTGTTCAAGGACTACAACCTGGAGCGCTATGGCCGGCTGC
AGCCCATCCTGGACAGCTTCCCCAAAGATGTGGACCTCAGCCAGCCCCGGAAGGGGAGGAAGCCCCCGGC
CGTCCCCAAGGCTTTGGTACCGCCACCCAGACTCCCCACCAAGAGGAAGGCCTCAGAAGAGGCTCGAGCT
GCCGCGCCAGCAGCCCTGACTCCAAGGGGCACCGCCAGCCCAGGCTCTCAACTGAAGGCCAAGCCCCCCA
AGAAGCCGGAGAGCAGCGCAGAGCAGCAGCGCCTTCCACTCGGGAACGGGATTCAGACCATGTCAGCTTC
AGTCCAGAGAGCTGTGGCCATGTCCTCCGGGGACGTCCCGGGAGCCCGAGGGGCCGTGGAGGGGATCCTC
ATCCAGCAGGTGTTTGAGTCAGGCGGCTCCAAGAAGTGCATCCAGGTTGGCGGGGAGTTCTACACTCCCA
GCAAGTTCGAAGACTCCGGCAGTGGGAAGAACAAGGCCCGCAGCAGCAGTGGCCCGAAGCCTCTGGTTCG
AGCCAAGGGAGCCCAGGGCGCTGCCCCCGGTGGAGGTGAGGCTAGGCTGGGCCAGCAGGGCAGCGTTCCC
GCCCCTCTGGCCCTCCCCAGTGACCCCCAGCTCCACCAGAAGAATGAGGACGAGTGTGCCGTGTGTCGGG
ACGGCGGGGAGCTCATCTGCTGTGACGGCTGCCCTCGGGCCTTCCACCTGGCCTGCCTGTCCCCTCCGCT
CCGGGAGATCCCCAGTGGGACCTGGAGGTGCTCCAGCTGCCTGCAGGCAACAGTCCAGGAGGTGCAGCCC
CGGGCAGAGGAGCCCCGGCCCCAGGAGCCACCCGTGGAGACCCCGCTCCCCCCGGGGCTTAGGTCGGCGG
GAGAGGAGGTAAGAGGTCCACCTGGGGAACCCCTAGCCGGCATGGACACGACTCTTGTCTACAAGCACCT
GCCGGCTCCGCCTTCTGCAGCCCCGCTGCCAGGGCTGGACTCCTCGGCCCTGCACCCCCTACTGTGTGTG
GGTCCTGAGGGTCAGCAGAACCTGGCTCCTGGTGCGCGTTGCGGGGTGTGCGGAGATGGTACGGACGTGC
TGCGGTGTACTCACTGCGCCGCTGCCTTCCACTGGCGCTGCCACTTCCCAGCCGGCACCTCCCGGCCCGG
GACGGGCCTGCGCTGCAGATCCTGCTCAGGAGACGTGACCCCAGCCCCTGTGGAGGGGGTGCTGGCCCCC
AGCCCCGCCCGCCTGGCCCCTGGGCCTGCCAAGGATGACACTGCCAGTCACGAGCCCGCTCTGCACAGGG
ATGACCTGGAGTCCCTTCTGAGCGAGCACACCTTCGATGGCATCCTGCAGTGGGCCATCCAGAGCATGGC
CCGTCCGGCGGCCCCCTTCCCCTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213497 representing NM_000383
Red=Cloning site Green=Tags(s)

MATDAALRRLLRLHRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALLSWLLTQD
STAILDFWRVLFKDYNLERYGRLQPILDSFPKDVDLSQPRKGRKPPAVPKALVPPPRLPTKRKASEEARA
AAPAALTPRGTASPGSQLKAKPPKKPESSAEQQRLPLGNGIQTMSASVQRAVAMSSGDVPGARGAVEGIL
IQQVFESGGSKKCIQVGGEFYTPSKFEDSGSGKNKARSSSGPKPLVRAKGAQGAAPGGGEARLGQQGSVP
APLALPSDPQLHQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQP
RAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDTTLVYKHLPAPPSAAPLPGLDSSALHPLLCV
GPEGQQNLAPGARCGVCGDGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAPVEGVLAP
SPARLAPGPAKDDTASHEPALHRDDLESLLSEHTFDGILQWAIQSMARPAAPFPS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000383
ORF Size 1635 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000383.1, NM_000383.2, NM_000383.3, NP_000374
RefSeq Size 2252
RefSeq ORF 1638
Locus ID 326
Cytogenetics 21q22.3
Protein Families Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis, Primary immunodeficiency
MW 57.5 kDa
Gene Summary This gene encodes a transcriptional regulator that forms nuclear bodies and interacts with the transcriptional coactivator CREB binding protein. The encoded protein plays an important role in immunity by regulating the expression of autoantigens and negative selection of autoreactive T-cells in the thymus. Mutations in this gene cause the rare autosomal-recessive systemic autoimmune disease termed autoimmune polyendocrinopathy with candidiasis and ectodermal dystrophy (APECED). [provided by RefSeq, Jun 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)