CTSA(CTSA) (NM_000308) Human Tagged ORF Clone

CAT#: RC213409

CTSA (Myc-DDK-tagged)-Human cathepsin A (CTSA), transcript variant 1

Change vector?

USD 639


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CTSA(CTSA) (NM_000308) Human Tagged ORF Clone
Symbol CTSA
Synonyms GLB2; GSL; NGBE; PPCA; PPGB
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC213409 representing NM_000308
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACTTCCAGTCCCCGGGCGCCTCCTGGAGAGCAAGGACGCGGGGGAGCAGAGATGATCCGAGCCGCGC
CGCCGCCGCTGTTCCTGCTGCTGCTGCTGCTGCTGCTAGTGTCCTGGGCGTCCCGAGGCGAGGCAGCCCC
CGACCAGGACGAGATCCAGCGCCTCCCCGGGCTGGCCAAGCAGCCGTCTTTCCGCCAGTACTCCGGCTAC
CTCAAAGGCTCCGGCTCCAAGCACCTCCACTACTGGTTTGTGGAGTCCCAGAAGGATCCCGAGAACAGCC
CTGTGGTGCTTTGGCTCAATGGGGGTCCCGGCTGCAGCTCACTAGATGGGCTCCTCACAGAGCATGGCCC
CTTCCTGGTCCAGCCAGATGGTGTCACCCTGGAGTACAACCCCTATTCTTGGAATCTGATTGCCAATGTG
TTATACCTGGAGTCCCCAGCTGGGGTGGGCTTCTCCTACTCCGATGACAAGTTTTATGCAACTAATGACA
CTGAGGTCGCCCAGAGCAATTTTGAGGCCCTTCAAGATTTCTTCCGCCTCTTTCCGGAGTACAAGAACAA
CAAACTTTTCCTGACCGGGGAGAGCTATGCTGGCATCTACATCCCCACCCTGGCCGTGCTGGTCATGCAG
GATCCCAGCATGAACCTTCAGGGGCTGGCTGTGGGCAATGGACTCTCCTCCTATGAGCAGAATGACAACT
CCCTGGTCTACTTTGCCTACTACCATGGCCTTCTGGGGAACAGGCTTTGGTCTTCTCTCCAGACCCACTG
CTGCTCTCAAAACAAGTGTAACTTCTATGACAACAAAGACCTGGAATGCGTGACCAATCTTCAGGAAGTG
GCCCGCATCGTGGGCAACTCTGGCCTCAACATCTACAATCTCTATGCCCCGTGTGCTGGAGGGGTGCCCA
GCCATTTTAGGTATGAGAAGGACACTGTTGTGGTCCAGGATTTGGGCAACATCTTCACTCGCCTGCCACT
CAAGCGGATGTGGCATCAGGCACTGCTGCGCTCAGGGGATAAAGTGCGCATGGACCCCCCCTGCACCAAC
ACAACAGCTGCTTCCACCTACCTCAACAACCCGTACGTGCGGAAGGCCCTCAACATCCCGGAGCAGCTGC
CACAATGGGACATGTGCAACTTTCTGGTAAACTTACAGTACCGCCGTCTCTACCGAAGCATGAACTCCCA
GTATCTGAAGCTGCTTAGCTCACAGAAATACCAGATCCTATTATATAATGGAGATGTAGACATGGCCTGC
AATTTCATGGGGGATGAGTGGTTTGTGGATTCCCTCAACCAGAAGATGGAGGTGCAGCGCCGGCCCTGGT
TAGTGAAGTACGGGGACAGCGGGGAGCAGATTGCCGGCTTCGTGAAGGAGTTCTCCCACATCGCCTTTCT
CACGATCAAGGGCGCCGGCCACATGGTTCCCACCGACAAGCCCCTCGCTGCCTTCACCATGTTCTCCCGC
TTCCTGAACAAGCAGCCATAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC213409 representing NM_000308
Red=Cloning site Green=Tags(s)

MTSSPRAPPGEQGRGGAEMIRAAPPPLFLLLLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGY
LKGSGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLDGLLTEHGPFLVQPDGVTLEYNPYSWNLIANV
LYLESPAGVGFSYSDDKFYATNDTEVAQSNFEALQDFFRLFPEYKNNKLFLTGESYAGIYIPTLAVLVMQ
DPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEV
ARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTN
TTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMAC
NFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSR
FLNKQPY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000308
ORF Size 1491 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000308.2, NM_000308.3, NP_000299
RefSeq Size 2254
RefSeq ORF 1497
Locus ID 5476
Cytogenetics 20q13.12
Domains serine_carbpept
Protein Families Protease, Druggable Genome
Protein Pathways Renin-angiotensin system
MW 56.12 kDa
Gene Summary This gene encodes a member of the peptidase S10 family of serine carboxypeptidases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate two chains that comprise the heterodimeric active enzyme. This enzyme possesses deamidase, esterase and carboxypeptidase activities and acts as a scaffold in the lysosomal multienzyme complex. Mutations in this gene are associated with galactosialidosis. [provided by RefSeq, Nov 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations