Factor XI (F11) (NM_000128) Human Tagged ORF Clone

CAT#: RC213056

Reviews ()
Write a review

F11 (Myc-DDK-tagged)-Human coagulation factor XI (F11)



  "NM_000128" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol F11
Synonyms FXI; PTA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC213056 representing NM_000128
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTTTCTTATATCAAGTGGTACATTTCATTTTATTTACTTCAGTTTCTGGTGAATGTGTGACTCAGT
TGTTGAAGGACACCTGCTTTGAAGGAGGGGACATTACTACGGTCTTCACACCAAGCGCCAAGTACTGCCA
GGTAGTCTGCACTTACCACCCAAGATGTTTACTCTTCACTTTCACGGCGGAATCACCATCTGAGGATCCC
ACCCGATGGTTTACTTGTGTCCTGAAAGACAGTGTTACAGAAACACTGCCAAGAGTGAATAGGACAGCAG
CGATTTCTGGGTATTCTTTCAAGCAATGCTCACACCAAATAAGCGCTTGCAACAAAGACATTTATGTGGA
CCTAGACATGAAGGGCATAAACTATAACAGCTCAGTTGCCAAGAGTGCTCAAGAATGCCAAGAAAGATGC
ACGGATGACGTCCACTGCCACTTTTTCACGTACGCCACAAGGCAGTTTCCCAGCCTGGAGCATCGTAACA
TTTGTCTACTGAAGCACACCCAAACAGGGACACCAACCAGAATAACGAAGCTCGATAAAGTGGTGTCTGG
ATTTTCACTGAAATCCTGTGCACTTTCTAATCTGGCTTGTATTAGGGACATTTTCCCTAATACGGTGTTT
GCAGACAGCAACATCGACAGTGTCATGGCTCCCGATGCTTTTGTCTGTGGCCGAATCTGCACTCATCATC
CCGGTTGCTTGTTTTTTACCTTCTTTTCCCAGGAATGGCCCAAAGAATCTCAAAGAAATCTTTGTCTCCT
TAAAACATCTGAGAGTGGATTGCCCAGTACACGCATTAAAAAGAGCAAAGCTCTTTCTGGTTTCAGTCTA
CAAAGCTGCAGGCACAGCATCCCAGTGTTCTGCCATTCTTCATTTTACCATGACACTGATTTCTTGGGAG
AAGAACTGGATATTGTTGCTGCAAAAAGTCACGAGGCCTGCCAGAAACTGTGCACCAATGCCGTCCGCTG
CCAGTTTTTTACCTATACCCCAGCCCAAGCATCCTGCAACGAAGGGAAGGGCAAGTGTTACTTAAAGCTT
TCTTCAAACGGATCTCCAACTAAAATACTTCACGGGAGAGGAGGCATCTCTGGATACACATTAAGGTTGT
GTAAAATGGATAATGAGTGTACCACCAAAATCAAGCCCAGGATCGTTGGAGGAACTGCGTCTGTTCGTGG
TGAGTGGCCGTGGCAGGTGACCCTGCACACAACCTCACCCACTCAGAGACACCTGTGTGGAGGCTCCATC
ATTGGAAACCAGTGGATATTAACAGCCGCTCACTGTTTCTATGGGGTAGAGTCACCTAAGATTTTGCGTG
TCTACAGTGGCATTTTAAATCAATCTGAAATAAAAGAGGACACATCTTTCTTTGGGGTTCAAGAAATAAT
AATCCATGATCAGTATAAAATGGCAGAAAGCGGGTATGATATTGCCTTGTTGAAACTGGAAACCACAGTG
AATTACACAGATTCTCAACGACCCATATGCCTGCCTTCCAAAGGAGATAGAAATGTAATATACACTGATT
GCTGGGTGACTGGATGGGGGTACAGAAAACTAAGAGACAAAATACAAAATACTCTCCAGAAAGCCAAGAT
ACCCTTAGTGACCAACGAAGAGTGCCAGAAGAGATACAGAGGACATAAAATAACCCATAAGATGATCTGT
GCCGGCTACAGGGAAGGAGGGAAGGACGCTTGCAAGGGAGATTCGGGAGGCCCTCTGTCCTGCAAACACA
ATGAGGTCTGGCATCTGGTAGGCATCACGAGCTGGGGCGAAGGCTGTGCTCAAAGGGAGCGGCCAGGTGT
TTACACCAACGTGGTCGAGTACGTGGACTGGATTCTGGAGAAAACTCAAGCAGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213056 representing NM_000128
Red=Cloning site Green=Tags(s)

MIFLYQVVHFILFTSVSGECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDP
TRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERC
TDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVF
ADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSL
QSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKL
SSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPRIVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSI
IGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTV
NYTDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMIC
AGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000128
ORF Size 1875 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000128.4
RefSeq Size 2217 bp
RefSeq ORF 1878 bp
Locus ID 2160
UniProt ID P03951
Cytogenetics 4q35.2
Domains APPLE, Tryp_SPc, PAN
Protein Families Druggable Genome, Protease, Secreted Protein
Protein Pathways Complement and coagulation cascades
MW 69.9 kDa
Gene Summary This gene encodes coagulation factor XI of the blood coagulation cascade. This protein is present in plasma as a zymogen, which is a unique plasma coagulation enzyme because it exists as a homodimer consisting of two identical polypeptide chains linked by disulfide bonds. During activation of the plasma factor XI, an internal peptide bond is cleaved by factor XIIa (or XII) in each of the two chains, resulting in activated factor XIa, a serine protease composed of two heavy and two light chains held together by disulfide bonds. This activated plasma factor XI triggers the middle phase of the intrisic pathway of blood coagulation by activating factor IX. Defects in this factor lead to Rosenthal syndrome, a blood coagulation abnormality. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal antibody to Factor XI (coagulation factor XI)
    • 100 ul

USD 473.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.