BMP1 (NM_001199) Human Tagged ORF Clone

CAT#: RC212538

BMP1 (Myc-DDK-tagged)-Human bone morphogenetic protein 1 (BMP1), transcript variant 1

Change vector?

USD 1,123


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name BMP1 (NM_001199) Human Tagged ORF Clone
Symbol BMP1
Synonyms OI13; PCOLC; PCP; PCP2; TLD
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC212538 representing NM_001199
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCGGCGTGGCCCGCCTGCCGCTGCTGCTCGGGCTGCTGCTGCTCCCGCGTCCCGGCCGGCCGCTGG
ACTTGGCCGACTACACCTATGACCTGGCGGAGGAGGACGACTCGGAGCCCCTCAACTACAAAGACCCCTG
CAAGGCGGCTGCCTTTCTTGGGGACATTGCCCTGGACGAAGAGGACCTGAGGGCCTTCCAGGTACAGCAG
GCTGTGGATCTCAGACGGCACACAGCTCGTAAGTCCTCCATCAAAGCTGCAGTTCCAGGAAACACTTCTA
CCCCCAGCTGCCAGAGCACCAACGGGCAGCCTCAGAGGGGAGCCTGTGGGAGATGGAGAGGTAGATCCCG
TAGCCGGCGGGCGGCGACGTCCCGACCAGAGCGTGTGTGGCCCGATGGGGTCATCCCCTTTGTCATTGGG
GGAAACTTCACTGGTAGCCAGAGGGCAGTCTTCCGGCAGGCCATGAGGCACTGGGAGAAGCACACCTGTG
TCACCTTCCTGGAGCGCACTGACGAGGACAGCTATATTGTGTTCACCTATCGACCTTGCGGGTGCTGCTC
CTACGTGGGTCGCCGCGGCGGGGGCCCCCAGGCCATCTCCATCGGCAAGAACTGTGACAAGTTCGGCATT
GTGGTCCACGAGCTGGGCCACGTCGTCGGCTTCTGGCACGAACACACTCGGCCAGACCGGGACCGCCACG
TTTCCATCGTTCGTGAGAACATCCAGCCAGGGCAGGAGTATAACTTCCTGAAGATGGAGCCTCAGGAGGT
GGAGTCCCTGGGGGAGACCTATGACTTCGACAGCATCATGCATTACGCTCGGAACACATTCTCCAGGGGC
ATCTTCCTGGATACCATTGTCCCCAAGTATGAGGTGAACGGGGTGAAACCTCCCATTGGCCAAAGGACAC
GGCTCAGCAAGGGGGACATTGCCCAAGCCCGCAAGCTTTACAAGTGCCCAGCCTGTGGAGAGACCCTGCA
AGACAGCACAGGCAACTTCTCCTCCCCTGAATACCCCAATGGCTACTCTGCTCACATGCACTGCGTGTGG
CGCATCTCTGTCACACCCGGGGAGAAGATCATCCTGAACTTCACGTCCCTGGACCTGTACCGCAGCCGCC
TGTGCTGGTACGACTATGTGGAGGTCCGAGATGGCTTCTGGAGGAAGGCGCCCCTCCGAGGCCGCTTCTG
CGGGTCCAAACTCCCTGAGCCTATCGTCTCCACTGACAGCCGCCTCTGGGTTGAATTCCGCAGCAGCAGC
AATTGGGTTGGAAAGGGCTTCTTTGCAGTCTACGAAGCCATCTGCGGGGGTGATGTGAAAAAGGACTATG
GCCACATTCAATCGCCCAACTACCCAGACGATTACCGGCCCAGCAAAGTCTGCATCTGGCGGATCCAGGT
GTCTGAGGGCTTCCACGTGGGCCTCACATTCCAGTCCTTTGAGATTGAGCGCCACGACAGCTGTGCCTAC
GACTATCTGGAGGTGCGCGACGGGCACAGTGAGAGCAGCACCCTCATCGGGCGCTACTGTGGCTATGAGA
AGCCTGATGACATCAAGAGCACGTCCAGCCGCCTCTGGCTCAAGTTCGTCTCTGACGGGTCCATTAACAA
AGCGGGCTTTGCCGTCAACTTTTTCAAAGAGGTGGACGAGTGCTCTCGGCCCAACCGCGGGGGCTGTGAG
CAGCGGTGCCTCAACACCCTGGGCAGCTACAAGTGCAGCTGTGACCCCGGGTACGAGCTGGCCCCAGACA
AGCGCCGCTGTGAGGCTGCCTGTGGCGGATTCCTCACCAAGCTCAACGGCTCCATCACCAGCCCGGGCTG
GCCCAAGGAGTACCCCCCCAACAAGAACTGCATCTGGCAGCTGGTGGCCCCCACCCAGTACCGCATCTCC
CTGCAGTTTGACTTCTTTGAGACAGAGGGCAATGATGTGTGCAAGTACGACTTCGTGGAGGTGCGCAGTG
GACTCACAGCTGACTCCAAGCTGCATGGCAAGTTCTGTGGTTCTGAGAAGCCCGAGGTCATCACCTCCCA
GTACAACAACATGCGCGTGGAGTTCAAGTCCGACAACACCGTGTCCAAAAAGGGCTTCAAGGCCCACTTC
TTCTCAGAAAAGAGGCCAGCTCTGCAGCCCCCTCGGGGACGCCCCCACCAGCTCAAATTCCGAGTGCAGA
AAAGAAACCGGACCCCCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC212538 representing NM_001199
Red=Cloning site Green=Tags(s)

MPGVARLPLLLGLLLLPRPGRPLDLADYTYDLAEEDDSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQ
AVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIG
GNFTGSQRAVFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGI
VVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRG
IFLDTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVW
RISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSS
NWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAY
DYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCE
QRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRIS
LQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHF
FSEKRPALQPPRGRPHQLKFRVQKRNRTPQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001199
ORF Size 2190 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001199.1, NM_001199.2, NM_001199.3, NP_001190
RefSeq Size 2487
RefSeq ORF 2193
Locus ID 649
Cytogenetics 8p21.3
Domains CUB, Astacin, EGF_CA, ZnMc, EGF, EGF
Protein Families Protease, Druggable Genome
MW 82.9 kDa
Gene Summary This gene encodes a protein that is capable of inducing formation of cartilage in vivo. Although other bone morphogenetic proteins are members of the TGF-beta superfamily, this gene encodes a protein that is not closely related to other known growth factors. This gene is expressed as alternatively spliced variants that share an N-terminal protease domain but differ in their C-terminal region. [provided by RefSeq, Aug 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations