HIST1H2AB (NM_003513) Human Tagged ORF Clone

CAT#: RC211585

HIST1H2AB (Myc-DDK-tagged)-Human histone cluster 1, H2ab (HIST1H2AB)

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HIST1H2AB (NM_003513) Human Tagged ORF Clone
Symbol HIST1H2AB
Synonyms H2A/m; H2AFM
Vector pCMV6-Entry
Sequence Data
>RC211585 representing NM_003513
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGGTCGCGGCAAACAAGGCGGTAAAGCTCGCGCCAAGGCTAAGACTCGGTCTTCTCGTGCAGGTT
TGCAGTTTCCTGTGGGCCGAGTGCACCGCCTGCTCCGCAAAGGCAACTACTCCGAGCGCGTCGGGGCTGG
CGCGCCGGTGTATCTCGCGGCGGTGCTTGAGTACCTGACCGCCGAGATCCTGGAGCTGGCGGGCAATGCG
GCCCGCGACAACAAGAAGACCCGCATCATCCCGCGCCACCTGCAATTGGCCATCCGCAATGACGAGGAGC
TTAATAAACTTTTGGGGCGTGTGACCATCGCGCAGGGTGGCGTTTTGCCTAATATTCAGGCGGTGCTGCT
GCCTAAGAAAACTGAGAGCCATCATAAGGCCAAGGGAAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC211585 representing NM_003513
Red=Cloning site Green=Tags(s)

MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNA
ARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003513
ORF Size 390 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003513.1, NM_003513.2, NP_003504
RefSeq Size 477
RefSeq ORF 393
Locus ID 8335
Cytogenetics 6p22.2
Protein Pathways Systemic lupus erythematosus
MW 14 kDa
Gene Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq, Aug 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)