SAP102 (DLG3) (NM_021120) Human Tagged ORF Clone

CAT#: RC210860

Reviews ()
Write a review

DLG3 (Myc-DDK-tagged)-Human discs, large homolog 3 (Drosophila) (DLG3), transcript variant 1



  "NM_021120" in other vectors (4)

Reconstitution Protocol

USD 748.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "DLG3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DLG3
Synonyms MRX; MRX90; NEDLG; PPP1R82; SAP102; XLMR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210860 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCACAAGCACCAGCACTGCTGTAAGTGCCCTGAGTGCTATGAGGTGACCCGCCTGGCCGCCCTGCGGC
GCCTCGAGCCTCCGGGCTACGGCGACTGGCAAGTCCCCGACCCTTACGGGCCAGGTGGGGGCAACGGCGC
CAGCGCGGGTTATGGGGGCTACAGCTCGCAGACCTTGCCCTCGCAGGCGGGGGCCACCCCCACCCCTCGC
ACCAAGGCCAAGCTCATCCCCACCGGCCGGGATGTGGGGCCGGTGCCTCCTAAGCCAGTCCCGGGCAAGA
GCACCCCCAAACTCAACGGCAGCGGCCCCAGCTGGTGGCCAGAGTGCACCTGTACCAACCGGGACTGGTA
TGAGCAGGTGAATGGCAGTGATGGCATGTTCAAATATGAGGAAATCGTACTTGAGAGGGGCAACTCTGGC
CTGGGCTTCAGTATCGCAGGTGGCATCGACAATCCCCATGTCCCTGATGACCCTGGCATCTTTATTACCA
AGATTATCCCTGGTGGAGCAGCTGCCATGGATGGGAGGCTGGGGGTGAATGACTGTGTGCTGCGGGTGAA
TGAGGTGGACGTGTCGGAGGTGGTACACAGCCGGGCGGTGGAGGCGCTGAAGGAGGCAGGCCCTGTGGTG
CGATTGGTGGTGCGGAGGCGACAGCCTCCACCCGAGACCATCATGGAGGTCAACCTGCTCAAAGGGCCCA
AAGGCCTGGGTTTCAGCATTGCTGGGGGTATTGGCAACCAGCACATCCCAGGAGACAACAGCATCTACAT
CACCAAGATCATTGAGGGGGGTGCTGCTCAGAAGGATGGACGCCTACAGATTGGGGACCGGCTGCTGGCG
GTGAACAACACCAATCTGCAGGATGTGAGGCACGAGGAAGCTGTGGCCTCACTGAAGAACACATCTGATA
TGGTGTATTTGAAGGTGGCCAAGCCAGGCAGCCTCCACCTCAACGACATGTACGCTCCCCCTGACTACGC
CAGCACTTTTACTGCCTTGGCTGACAACCACATAAGCCATAATTCCAGCCTGGGTTATCTCGGGGCTGTG
GAGAGCAAGGTCAGCTACCCTGCTCCTCCTCAGGTTCCCCCCACCCGCTACTCTCCTATTCCCAGGCACA
TGCTGGCTGAGGAGGACTTCACCAGAGAGCCTCGCAAGATCATCCTGCACAAAGGCTCCACAGGCCTGGG
CTTCAACATCGTAGGAGGAGAGGATGGAGAAGGCATTTTTGTCTCCTTCATCCTGGCAGGAGGCCCAGCT
GACCTGAGTGGGGAGCTGCGCAGGGGAGACCGGATCTTATCGGTGAATGGAGTGAATCTGAGGAATGCAA
CTCATGAGCAGGCTGCAGCTGCTCTGAAACGGGCCGGCCAGTCAGTCACCATTGTGGCCCAGTACAGACC
TGAAGAATACAGTCGCTTTGAATCGAAGATACATGACTTACGAGAACAAATGATGAACAGCAGCATGAGC
TCTGGGTCTGGGTCCCTCCGAACAAGTGAAAAGAGGTCCTTGTATGTCAGGGCCCTGTTTGATTATGATC
GGACTCGGGACAGCTGCCTGCCAAGCCAGGGGCTCAGCTTCTCTTATGGTGACATTCTGCATGTCATTAA
TGCCTCTGATGATGAGTGGTGGCAGGCAAGGCTGGTGACCCCACACGGAGAAAGTGAGCAGATCGGTGTG
ATCCCCAGTAAGAAGAGGGTGGAAAAGAAAGAAAGAGCTCGATTGAAAACTGTGAAGTTCCATGCCAGGA
CGGGGATGATTGAGTCTAACAGGGACTTCCCGGGGTTAAGTGACGATTATTATGGAGCAAAGAACCTGAA
AGGACAAGAGGATGCTATTTTGTCATATGAGCCAGTGACACGGCAAGAAATTCACTATGCAAGGCCTGTG
ATCATCCTGGGCCCAATGAAGGACCGAGTCAATGATGACCTGATCTCCGAATTTCCACATAAATTTGGAT
CCTGTGTGCCACATACTACCCGGCCTCGACGTGATAATGAGGTGGATGGACAAGACTACCACTTTGTGGT
GTCCCGAGAACAAATGGAGAAAGATATTCAGGACAACAAGTTCATCGAGGCGGGCCAATTTAATGATAAC
CTCTATGGGACCAGCATCCAGTCAGTGCGGGCAGTTGCAGAGAGGGGCAAGCACTGCATCTTAGATGTTT
CCGGCAATGCTATCAAGAGACTGCAGCAAGCACAACTTTACCCCATTGCCATTTTCATCAAGCCCAAGTC
CATTGAAGCCCTTATGGAAATGAACCGAAGGCAGACATATGAACAAGCAAATAAGATCTATGACAAAGCC
ATGAAACTGGAGCAGGAATTTGGAGAGTACTTTACAGCCATTGTACAGGGTGACTCACTGGAAGAGATTT
ATAACAAAATCAAACAAATCATTGAGGACCAGTCTGGGCACTACATTTGGGTCCCATCCCCTGAAAAACT
C


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210860 protein sequence
Red=Cloning site Green=Tags(s)

MHKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASAGYGGYSSQTLPSQAGATPTPR
TKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQVNGSDGMFKYEEIVLERGNSG
LGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVV
RLVVRRRQPPPETIMEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLA
VNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSLHLNDMYAPPDYASTFTALADNHISHNSSLGYLGAV
ESKVSYPAPPQVPPTRYSPIPRHMLAEEDFTREPRKIILHKGSTGLGFNIVGGEDGEGIFVSFILAGGPA
DLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMS
SGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGV
IPSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDYYGAKNLKGQEDAILSYEPVTRQEIHYARPV
IILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDN
LYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKIYDKA
MKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_021120
ORF Size 2451 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_021120.4
RefSeq Size 6032 bp
RefSeq ORF 2454 bp
Locus ID 1741
UniProt ID Q92796
Cytogenetics Xq13.1
Domains SH3, PDZ, Guanylate_kin, GuKc
MW 90.3 kDa
Gene Summary This gene encodes a member of the membrane-associated guanylate kinase protein family. The encoded protein may play a role in clustering of NMDA receptors at excitatory synapses. It may also negatively regulate cell proliferation through interaction with the C-terminal region of the adenomatosis polyposis coli tumor suppressor protein. Mutations in this gene have been associated with X-linked cognitive disability. Alternatively spliced transcript variants have been described. [provided by RefSeq, Oct 2009]

Other Versions

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.