IL1 Receptor I (IL1R1) (NM_000877) Human Tagged ORF Clone

CAT#: RC210412

Reviews ()
Write a review

IL1R1 (Myc-DDK-tagged)-Human interleukin 1 receptor, type I (IL1R1)



Reconstitution Protocol

USD 530.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "IL1R1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol IL1R1
Synonyms CD121A; D2S1473; IL-1R-alpha; IL1R; IL1RA; P80
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC210412 representing NM_000877
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAGTGTTACTCAGACTTATTTGTTTCATAGCTCTACTGATTTCTTCTCTGGAGGCTGATAAATGCA
AGGAACGTGAAGAAAAAATAATTTTAGTGTCATCTGCAAATGAAATTGATGTTCGTCCCTGTCCTCTTAA
CCCAAATGAACACAAAGGCACTATAACTTGGTATAAAGATGACAGCAAGACACCTGTATCTACAGAACAA
GCCTCCAGGATTCATCAACACAAAGAGAAACTTTGGTTTGTTCCTGCTAAGGTGGAGGATTCAGGACATT
ACTATTGCGTGGTAAGAAATTCATCTTACTGCCTCAGAATTAAAATAAGTGCAAAATTTGTGGAGAATGA
GCCTAACTTATGTTATAATGCACAAGCCATATTTAAGCAGAAACTACCCGTTGCAGGAGACGGAGGACTT
GTGTGCCCTTATATGGAGTTTTTTAAAAATGAAAATAATGAGTTACCTAAATTACAGTGGTATAAGGATT
GCAAACCTCTACTTCTTGACAATATACACTTTAGTGGAGTCAAAGATAGGCTCATCGTGATGAATGTGGC
TGAAAAGCATAGAGGGAACTATACTTGTCATGCATCCTACACATACTTGGGCAAGCAATATCCTATTACC
CGGGTAATAGAATTTATTACTCTAGAGGAAAACAAACCCACAAGGCCTGTGATTGTGAGCCCAGCTAATG
AGACAATGGAAGTAGACTTGGGATCCCAGATACAATTGATCTGTAATGTCACCGGCCAGTTGAGTGACAT
TGCTTACTGGAAGTGGAATGGGTCAGTAATTGATGAAGATGACCCAGTGCTAGGGGAAGACTATTACAGT
GTGGAAAATCCTGCAAACAAAAGAAGGAGTACCCTCATCACAGTGCTTAATATATCGGAAATTGAAAGTA
GATTTTATAAACATCCATTTACCTGTTTTGCCAAGAATACACATGGTATAGATGCAGCATATATCCAGTT
AATATATCCAGTCACTAATTTCCAGAAGCACATGATTGGTATATGTGTCACGTTGACAGTCATAATTGTG
TGTTCTGTTTTCATCTATAAAATCTTCAAGATTGACATTGTGCTTTGGTACAGGGATTCCTGCTATGATT
TTCTCCCAATAAAAGCTTCAGATGGAAAGACCTATGACGCATATATACTGTATCCAAAGACTGTTGGGGA
AGGGTCTACCTCTGACTGTGATATTTTTGTGTTTAAAGTCTTGCCTGAGGTCTTGGAAAAACAGTGTGGA
TATAAGCTGTTCATTTATGGAAGGGATGACTACGTTGGGGAAGACATTGTTGAGGTCATTAATGAAAACG
TAAAGAAAAGCAGAAGACTGATTATCATTTTAGTCAGAGAAACATCAGGCTTCAGCTGGCTGGGTGGTTC
ATCTGAAGAGCAAATAGCCATGTATAATGCTCTTGTTCAGGATGGAATTAAAGTTGTCCTGCTTGAGCTG
GAGAAAATCCAAGACTATGAGAAAATGCCAGAATCGATTAAATTCATTAAGCAGAAACATGGGGCTATCC
GCTGGTCAGGGGACTTTACACAGGGACCACAGTCTGCAAAGACAAGGTTCTGGAAGAATGTCAGGTACCA
CATGCCAGTCCAGCGACGGTCACCTTCATCTAAACACCAGTTACTGTCACCAGCCACTAAGGAGAAACTG
CAAAGAGAGGCTCACGTGCCTCTCGGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC210412 representing NM_000877
Red=Cloning site Green=Tags(s)

MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQ
ASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGL
VCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPIT
RVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYS
VENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIV
CSVFIYKIFKIDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG
YKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQDGIKVVLLEL
EKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPVQRRSPSSKHQLLSPATKEKL
QREAHVPLG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000877
ORF Size 1707 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000877.4
RefSeq Size 4909 bp
RefSeq ORF 1710 bp
Locus ID 3554
UniProt ID P14778
Cytogenetics 2q11.2-q12.1
Domains TIR, IG
Protein Families Druggable Genome, Transmembrane
Protein Pathways Apoptosis, Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, MAPK signaling pathway
MW 65.4 kDa
Gene Summary This gene encodes a cytokine receptor that belongs to the interleukin-1 receptor family. The encoded protein is a receptor for interleukin-1 alpha, interleukin-1 beta, and interleukin-1 receptor antagonist. It is an important mediator involved in many cytokine-induced immune and inflammatory responses. This gene is located in a cluster of related cytokine receptor genes on chromosome 2q12. [provided by RefSeq, Dec 2013]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.